Details for Capsella Locus Carubv10013871m

Position : scaf_3 ( 5`- 4278269 .. 4280717 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013871m

Protein [Map View]
MSSGDTLSKLAQFISSSDKFFRRGDGDGGFCYCWATVLALVFILLYQFFVSRKLRFFSLATSSPAVSITQSQNFQSGIST
LVSDEDLKGLIEKLGERNEDAEVWEDVIQKSNPRVSYSAKCCKPKDGGPMKYLSITVFEDCSPEVLRDFYMDNEYRTQWD
KTVVEHQQLQVDSITGIETGRTIKKFPLLTPREYVLAWRLWEGKDKFYCFIKECDHSMVPQRRKYVRVNYFRSGWRISKV
PGRNACEIHMFHQEDAGLNVEMAKLAFSKGIWSYVCKMENALRKYVVTSHRPQGSTLSAVSLMKKIPSELESQTSDITNS
LGTTTSGLQTGEGDKQKKLLRKPSKKLIANGLLLAGGAVGGAICLSRGHSALGAKVALAYFLSKMRKRGAPLSQTSHDAG
I*

DNA
ATGAGTAGTGGGGATACCTTATCGAAGTTAGCTCAATTTATCTCCTCTTCCGATAAATTTTTCCGGCGAGGTGATGGTGA
TGGAGGCTTTTGTTATTGCTGGGCTACTGTCCTCGCTCTTGTCTTCATTCTTCTCTACCAATTTTTCGTTTCCCGGAAAC
TTCGATTCTTCAGTCTTGCTACTTCTTCCCCAGCCGTCTCGATTACTCAATCTCAGAACTTTCAATCAGGAATCTCGACA
CTTGTTTCTGATGAAGATCTAAAGGGCCTGATTGAGAAACTGGGGGAAAGAAATGAAGATGCTGAGGTATGGGAAGATGT
TATTCAGAAAAGCAACCCTCGCGTGTCATACAGTGCTAAATGCTGCAAACCAAAAGATGGTGGTCCCATGAAGTACCTTA
GTATTACGGTGTTTGAGGACTGTTCGCCAGAGGTTTTGAGGGACTTCTATATGGATAATGAGTATAGGACCCAATGGGAT
AAAACTGTGGTTGAGCATCAGCAATTGCAGGTTGATAGTATTACTGGGATTGAGACTGGTCGCACTATAAAAAAGTTTCC
TTTGTTGACACCAAGGGAGTATGTATTAGCTTGGAGATTGTGGGAGGGGAAAGATAAGTTTTACTGTTTCATCAAGGAAT
GTGATCACAGTATGGTGCCACAACGAAGGAAGTATGTACGTGTAAATTATTTCAGATCTGGTTGGCGAATCAGTAAAGTT
CCTGGTAGGAACGCTTGTGAAATCCACATGTTTCATCAGGAAGATGCTGGATTAAATGTTGAGATGGCAAAGCTTGCTTT
TTCAAAAGGCATATGGAGCTATGTTTGTAAGATGGAAAATGCTCTTCGTAAATACGTTGTAACAAGTCATAGACCTCAAG
GGTCCACTTTATCTGCTGTCAGCTTAATGAAAAAGATTCCATCAGAGTTAGAAAGTCAGACAAGTGACATCACAAACTCC
TTGGGAACTACCACTAGTGGTCTGCAAACAGGTGAAGGAGACAAACAAAAGAAACTGTTGAGAAAGCCTTCAAAGAAACT
GATAGCAAATGGTTTGTTACTCGCGGGTGGTGCAGTTGGTGGTGCAATCTGTCTGTCCCGTGGTCACTCCGCCTTGGGTG
CAAAGGTTGCCTTGGCTTACTTCCTGTCAAAGATGAGAAAGCGTGGAGCTCCGCTGAGTCAGACTTCCCACGACGCTGGT
ATTTAA