Details for Capsella Locus Carubv10013864m

Position : scaf_3 ( 5`- 1240350 .. 1243158 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013864m

Protein [Map View]
MEPNESHHHHQQQQHQQHQQQQQQHHQQRLGSPYFHHQLQHHHYPTAVATSTSTGNAVPSSNNGLFPPQPQPNDGSSSIA
VYPHSVPSSAVTAPMEPLKRKRGRPRKYVTPEQALAAKKMASSASSSAKERRELAAIAAGTAPSKSGSSKKSQLGSVGKT
GQSFIPHIVNIAPGEDVAQKILIFANQSKHELCVLSASGTISNASLRQPASSGGNVSYEGQYEILSLSGSYIRTEQGGKT
GGLSASLSGSDGQIIGGAIGTHLTAAGPVQVILGTFQFDRKKDAAGSGVKGDASNSGNQLTSPASTGPILDMGFRPGMES
TGRNPMRGHDEQHHHHQTGLSGSHHFMMQAPQGMHMTHTRPSEWGRGGNSGHDGRGGGGYDLSGRLGHESSENGDYEQQI
PD*

DNA
ATGGAACCTAACGAAAGCCACCATCACCACCAACAACAGCAGCACCAGCAGCACCAGCAGCAGCAACAGCAACATCACCA
GCAACGACTCGGTTCCCCTTACTTCCACCACCAACTACAGCACCACCACTATCCCACCGCCGTAGCTACCTCTACTTCTA
CCGGAAACGCCGTTCCATCTTCCAACAATGGGCTTTTCCCGCCGCAGCCGCAGCCTAATGATGGCTCTTCCTCAATTGCG
GTGTACCCTCATTCAGTTCCCTCCTCCGCCGTGACGGCGCCGATGGAGCCGTTAAAGAGGAAGAGAGGTCGACCGAGGAA
GTATGTGACCCCTGAACAAGCCCTAGCGGCTAAGAAAATGGCGTCCTCTGCGAGCAGTTCTGCTAAAGAGAGGAGAGAGC
TAGCTGCTATTGCCGCAGGTACGGCACCGTCTAAATCCGGGTCATCCAAGAAATCGCAGCTTGGTTCTGTCGGGAAAACG
GGGCAAAGCTTTATTCCTCATATCGTTAATATTGCTCCTGGCGAGGATGTGGCACAGAAGATTTTGATTTTCGCAAACCA
AAGCAAGCATGAACTATGCGTTCTTTCTGCATCAGGCACCATCTCTAATGCATCCTTGCGCCAGCCGGCTTCATCAGGAG
GCAACGTATCATATGAGGGTCAGTACGAGATTCTCTCACTATCTGGATCATATATCCGGACCGAACAAGGTGGTAAAACT
GGTGGCCTTAGTGCTTCTTTATCTGGTTCAGATGGCCAGATCATCGGTGGAGCGATTGGGACCCACCTCACAGCTGCTGG
CCCGGTTCAGGTGATTCTTGGTACGTTTCAGTTTGATAGAAAGAAGGATGCTGCCGGGAGTGGTGTGAAAGGGGATGCTT
CAAACAGCGGAAATCAGTTAACCTCTCCCGCTAGCACTGGACCGATACTTGACATGGGCTTCCGTCCTGGTATGGAATCT
ACGGGAAGAAATCCAATGCGGGGACACGATGAGCAGCATCATCATCATCAAACTGGTTTGAGTGGATCTCATCATTTCAT
GATGCAGGCGCCGCAGGGAATGCATATGACACACACCCGGCCTTCTGAATGGGGCAGAGGAGGCAACAGCGGTCATGATG
GTAGAGGCGGTGGTGGGTATGACTTATCAGGACGGTTAGGACATGAGTCGTCGGAGAATGGGGATTACGAGCAGCAAATA
CCGGATTAG