Details for Capsella Locus Carubv10013863m

Position : scaf_3 ( 5`- 6569434 .. 6570993 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013863m

Protein [Map View]
MRTRRKIYSAATPPVSESVTARPIVQALPASATRSCYAKSRGGNVGSKKQCIGGLWDVKIPKEMLQEILSRIGLKANIHA
SLVCKTWLQAAVSIRKLENPPCLLYPHKGSKDGDYLLFDPSRSLTYQLKFPDFKDHIFLCSRDGWLLVKNDGFSDVIFFF
NPFTGERIYLPSKQRYFTGYGLTFSAAPTSSSCCVLSFIFQTLDVFFVVETWRPGDSVWTLHHFPNKFYGPGTARCVFSN
GKFYCLSTSGYVGVFDPFEVTWNIPKMNPCPIYNRCHFRLVRPVLMTEHDGDVFVMTTRRRNHSKLLVFRLNVERNVWEE
MSGLGGLTVFACFAAALTRAGLPAEERNRVYTSHIGDGYGKFGIYYLGCVRCTQPSYTSYMSIRSAWVQPPPHNNFSFRL
HP*

DNA
ATGAGGACGCGCCGGAAAATATACTCGGCGGCAACTCCACCGGTCTCTGAATCCGTCACGGCGAGGCCCATAGTTCAAGC
GCTTCCAGCGTCAGCCACAAGATCATGCTATGCAAAATCTAGAGGAGGAAATGTTGGATCGAAGAAGCAGTGTATTGGAG
GACTGTGGGATGTGAAAATTCCGAAAGAGATGCTGCAAGAGATACTCTCTCGGATCGGACTAAAAGCTAACATACACGCT
TCTCTTGTCTGCAAGACATGGCTTCAAGCAGCTGTTTCCATCAGGAAGTTGGAGAATCCTCCTTGCCTTTTGTATCCACA
CAAAGGATCAAAAGACGGCGACTACCTTCTTTTTGACCCGTCACGGTCTCTAACGTATCAGCTCAAGTTTCCAGACTTCA
AGGACCATATATTCTTGTGTTCTAGGGATGGTTGGTTGCTCGTCAAAAATGATGGCTTCTCTGATGTGATTTTCTTCTTT
AATCCGTTTACTGGGGAACGCATCTACTTACCCAGTAAGCAACGATATTTCACAGGCTATGGCTTAACTTTCTCAGCCGC
TCCCACATCAAGTAGTTGTTGTGTGCTCTCTTTCATCTTTCAAACTTTGGACGTCTTTTTTGTGGTTGAAACTTGGCGGC
CTGGTGATTCTGTATGGACCCTTCATCATTTTCCGAATAAGTTTTATGGTCCCGGAACTGCTAGATGCGTCTTCTCCAAT
GGTAAATTCTATTGCCTCAGTACAAGCGGCTACGTCGGCGTTTTCGACCCGTTTGAGGTAACCTGGAATATTCCTAAAAT
GAATCCATGTCCCATCTATAATCGTTGTCACTTTAGACTCGTGAGGCCAGTGCTCATGACAGAGCATGACGGAGACGTCT
TTGTTATGACTACACGCCGCAGAAACCACAGCAAACTGTTGGTGTTTAGACTAAACGTTGAACGCAACGTGTGGGAAGAG
ATGAGTGGACTTGGTGGATTGACAGTATTTGCATGTTTTGCTGCCGCTCTCACAAGAGCTGGTCTCCCAGCGGAGGAGAG
GAACAGAGTGTATACATCTCATATTGGTGATGGTTATGGGAAATTTGGCATTTACTACCTTGGTTGTGTGAGATGTACTC
AACCTTCTTACACTTCCTATATGTCTATCCGCAGCGCTTGGGTGCAGCCACCACCTCACAACAACTTTAGTTTTCGACTT
CATCCTTAA