Details for Capsella Locus Carubv10013861m

Position : scaf_3 ( 5`- 1244687 .. 1247926 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013861m

Protein [Map View]
MEVDKKDERESESSEQVVNPWEVSAKDGGKIDYDKLIDKFGCQRLDESLIDRVQRLTSRQPHVFLRRGVFFAHRDFNEIL
DAYEKGDKFYLYTGRGPSSEALHLGHLIPFMFTKYLQEAFKVPLVIQLTDDEKCLWKNLSVEESQRLARENAKDIIACGF
DVTKTFIFSDFDYVGGAFYKNMVKVSKCVTLNKAIGIFGFSGEDPIGKLSFPPVQAVPSFPSSFPHLFPGKDNLRCLIPC
AIDQDPYFRMTRDVAPRLGYSKPALIESSFFPALQGENGKMSASDPNSAIYVTDTAKEIKNKINRYAFSGGQESVEKHRE
LGANLEVDIPVKYLSFFLEDDSELEHIKKEYGEGRMLTGEVKKRLTEVLTEMVERHRRARAAVTDEMVDAFMAVRPLPSM
FE*

DNA
ATGGAGGTGGATAAGAAGGATGAGAGAGAGTCTGAATCTTCGGAGCAAGTGGTGAATCCATGGGAAGTATCTGCCAAAGA
CGGTGGGAAGATCGATTACGATAAGCTCATTGACAAATTTGGTTGTCAGAGGCTTGACGAATCACTGATTGATCGTGTTC
AGAGACTAACTTCTCGTCAACCACACGTATTTCTCCGCCGTGGTGTCTTCTTCGCCCACCGGGATTTCAATGAGATTTTG
GACGCCTACGAGAAAGGAGACAAGTTCTATCTCTACACTGGAAGAGGACCTTCGTCAGAAGCTTTACATTTAGGGCATTT
GATTCCTTTCATGTTTACCAAATACTTGCAAGAAGCTTTCAAGGTTCCCCTTGTTATACAGCTCACTGATGATGAAAAAT
GCTTGTGGAAGAACTTATCGGTGGAGGAAAGTCAAAGACTTGCCAGAGAAAATGCGAAAGATATAATTGCTTGTGGGTTC
GATGTAACAAAGACCTTCATTTTCTCTGACTTCGACTATGTTGGTGGTGCTTTCTATAAAAACATGGTGAAGGTCTCCAA
GTGCGTTACCCTTAATAAGGCTATTGGAATCTTTGGCTTTTCCGGTGAAGATCCTATCGGGAAACTGAGTTTCCCTCCTG
TGCAGGCAGTTCCATCTTTTCCTAGCTCATTCCCACATTTGTTCCCTGGCAAGGACAATCTCCGCTGTTTGATTCCTTGT
GCTATTGACCAGGATCCTTATTTTAGAATGACTCGTGATGTTGCACCCCGGTTAGGCTATAGCAAGCCGGCCCTGATTGA
GTCATCATTTTTTCCTGCTCTGCAGGGAGAGAATGGAAAAATGTCTGCTAGTGATCCAAATTCTGCTATCTATGTGACCG
ATACCGCGAAAGAAATTAAAAACAAGATAAACAGATATGCGTTTAGTGGTGGACAGGAGTCCGTCGAGAAGCACAGAGAA
CTTGGAGCAAATCTCGAGGTAGACATACCCGTCAAGTATCTAAGTTTCTTCCTCGAAGATGATTCCGAACTAGAACACAT
TAAAAAGGAGTACGGAGAAGGAAGAATGCTAACGGGGGAAGTAAAGAAGAGACTTACTGAAGTGTTGACAGAAATGGTGG
AGAGACACCGAAGGGCTCGAGCTGCTGTTACTGATGAGATGGTGGATGCTTTCATGGCTGTGAGACCTCTCCCAAGCATG
TTCGAATAG