Details for Capsella Locus Carubv10013860m

Position : scaf_3 ( 5`- 4717140 .. 4718769 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013860m

Protein [Map View]
MMSLSGNSGRTIERPPFTPTQWQELEHQALIYKYMVSGVPVPPELIFSIRRSLDSTLVSRLLPHQSLGWGCYQMGFGRKP
DPEPGRCRRTDGKKWRCSREAYPDSKYCEKHMHRGRNRARKSLDQNQTTTPLTSPSLSFPNNNNPSPTLSSSSSSSSSTT
TYSASSSSLDAYSNQNRFGVGGSSSNTRGYFNSHSLDYPYPATSPKQQQQQPLHHASALSLHQTTNPTSQFNVLASATDN
KDFRYFQGIGERIGVGERTFFPEASRSFQDSPYHHQQPLATVMNDPYHHCSTDQKIDHHHTYSSSSSSQHLHHDHEQDNH
HRQQQQQCFVLGADMFNKPTRSSVLANSSRQDQNQKEEEKDSSESKKSLHHFFGEDWAQNKTSDSWLDLSSHSRLDTGNY
CKR*

DNA
ATGATGAGCCTAAGTGGAAATAGTGGAAGAACAATAGAGAGGCCTCCATTTACACCAACACAATGGCAAGAACTGGAACA
CCAGGCCCTAATTTACAAGTACATGGTCTCTGGTGTTCCTGTCCCACCTGAGCTCATCTTCTCCATTAGAAGAAGCTTGG
ACTCTACCTTGGTCTCTAGACTCCTCCCTCATCAATCCCTTGGATGGGGATGTTACCAGATGGGATTTGGGAGGAAACCA
GACCCAGAACCAGGAAGATGCAGGAGAACAGATGGCAAGAAGTGGAGATGCTCAAGAGAAGCTTACCCAGATTCTAAGTA
CTGTGAAAAACACATGCACAGAGGAAGGAACCGTGCAAGAAAATCTCTTGATCAGAATCAGACAACAACTCCTTTAACAT
CACCATCTCTCTCATTCCCCAACAACAACAACCCAAGTCCCACCTTGTCTTCTTCTTCCTCATCTTCCTCTTCCACTACC
ACCTATTCTGCTTCTTCTTCTTCACTGGATGCTTACAGTAACCAAAATAGGTTTGGTGTTGGTGGAAGTAGCAGTAACAC
TAGAGGTTACTTCAACAGCCATTCTCTTGATTACCCTTACCCTGCTACTTCACCTAAACAACAACAGCAACAACCTCTTC
ATCATGCTTCTGCTTTATCACTTCATCAAACCACTAATCCTACTTCTCAGTTCAATGTCTTAGCCTCTGCTACTGACAAC
AAAGACTTCAGGTATTTTCAAGGTATTGGGGAGAGAATTGGAGTTGGAGAGAGGACGTTTTTTCCGGAAGCATCTAGAAG
CTTTCAAGATTCTCCATACCATCACCAACAACCGTTAGCAACAGTGATGAATGATCCGTACCACCACTGTAGCACTGATC
AAAAGATTGATCATCATCACACATACTCATCCTCATCATCATCTCAACATCTTCATCATGATCATGAGCAGGATAATCAT
CACCGACAGCAACAGCAACAGTGTTTCGTTTTGGGAGCCGACATGTTCAACAAACCCACCAGAAGTAGTGTCCTTGCAAA
TTCATCAAGACAAGATCAAAACCAAAAAGAAGAGGAGAAAGATTCATCGGAATCAAAGAAGTCTCTTCATCATTTCTTCG
GTGAGGACTGGGCTCAGAACAAGACTTCAGATTCCTGGCTTGACCTTTCTTCCCACTCAAGACTGGACACTGGTAATTAC
TGCAAAAGATAA