Details for Capsella Locus Carubv10013856m

Position : scaf_3 ( 5`- 3012362 .. 3015102 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013856m

Protein [Map View]
MWQVVLGAAIAGSTSFVAKRFFNPFSRDSRLPENYAEEQETLTPPVGIGFLDSSFDKTDGVFRFSSSGSAVNSGSGFGSG
SSSGFRKISGAKCRVRFRGLMNKKKKKNGGGCEIEKRSANVGALETKSEVCSKKTKTLGAASASKRGSCYTNQDHSSFSS
VLGVCMMYMVSAEKTEISKLNTATEETTKAIQELKDELSRIKSLQYFKFRGCAASSEKSSGRSRSEMASRESLDMKSGVN
GEYASSVLTEEPEQETVEMEQLEMELESELQKLNLAETNEVMEECKDLVNRSESYQCGGISASELDKKLSHLLIEQQEGQ
INELEAELQTTQSKLQEKEAELQALKVCVRRLTEFPLLDRSDDEHEEDQNPNLSVSWNQHNQTDKEVRKQIIGTKRPMES
SVHV*

DNA
ATGTGGCAAGTTGTTCTAGGAGCAGCCATTGCTGGATCCACTAGTTTTGTAGCCAAACGGTTCTTCAACCCTTTCTCTCG
AGATTCACGCCTTCCCGAGAATTACGCTGAAGAGCAGGAAACCCTCACTCCTCCTGTGGGTATTGGATTTCTCGATTCTT
CTTTCGACAAAACCGATGGTGTTTTCCGGTTTTCTAGTTCAGGGTCTGCCGTTAACTCAGGGTCCGGATTCGGATCCGGG
TCATCTTCTGGGTTTAGGAAGATTTCAGGGGCGAAATGCAGAGTTAGGTTTCGTGGATTGATGAATAAGAAGAAGAAAAA
GAATGGTGGGGGATGTGAGATCGAGAAGCGATCTGCAAATGTTGGTGCTTTGGAAACGAAGAGTGAGGTTTGCTCAAAAA
AGACGAAAACTTTGGGTGCTGCTTCAGCTTCTAAACGCGGATCATGTTATACTAATCAAGATCATTCCTCTTTCAGCTCG
GTACTTGGTGTCTGCATGATGTATATGGTGTCAGCCGAAAAAACTGAAATCAGTAAGCTGAATACAGCAACAGAAGAAAC
TACCAAAGCCATCCAGGAGCTAAAAGACGAACTTTCTAGGATAAAATCTTTACAGTATTTCAAATTTCGTGGTTGTGCAG
CGAGTTCTGAGAAATCAAGTGGAAGATCTAGATCAGAGATGGCGAGTAGAGAATCTCTCGACATGAAGTCGGGAGTTAAT
GGAGAATATGCTAGCAGCGTCTTAACTGAGGAGCCAGAACAAGAGACGGTAGAAATGGAACAGTTAGAGATGGAACTTGA
ATCTGAGCTGCAGAAACTGAATTTGGCTGAGACAAATGAGGTTATGGAGGAATGTAAGGATCTGGTAAATAGATCTGAGT
CATATCAATGTGGTGGTATATCGGCATCAGAGCTGGACAAGAAACTAAGCCACCTTCTCATCGAACAGCAAGAAGGCCAG
ATCAATGAGCTTGAAGCTGAACTACAAACCACTCAGTCCAAACTCCAAGAGAAAGAAGCTGAACTTCAAGCGCTTAAGGT
CTGCGTTAGACGCCTGACAGAGTTTCCTCTGTTGGACCGTTCAGATGACGAGCATGAAGAAGACCAGAACCCAAATCTGT
CAGTCTCGTGGAACCAGCATAACCAAACTGATAAGGAGGTAAGAAAGCAGATCATTGGGACGAAAAGGCCTATGGAGTCA
TCTGTGCATGTTTAA