Details for Capsella Locus Carubv10013853m

Position : scaf_3 ( 5`- 1508274 .. 1509905 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013853m

Protein [Map View]
MAGSDDHHRNPYMAFPGVFPIVFLLVLSSADLAASQSQPGPTNQPYNYGRLSPAMAVIVVILIAALFFMGFFSIYFRHCS
GVPDAGVSPAGAARSRGTVNAAARGLDAAVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPKCDHVFHPH
CIGAWLEAHVTCPVCRANLAEQVAEGESVEPGGTEPDLELQQVAPNPEPVLTAPVPEELATSEIDSRRLPGVPVDLKRVN
KFSRSHTTGHSVVQPGECTERFTLRLPEDVRKRIMRDWKLNRSNSVLVLPRGGSSRRGKPIDRSRARSDRWLFRKTPSFL
WRSRDDGSIRLGSTGSVRANPVPNPTGGDSVRGGERWAFLRNASFLWRNSSVHVQRGGVNKDGEGTSVNPTGPSGSRSGS
VRLPV*

DNA
ATGGCAGGCTCCGATGATCATCATAGGAATCCATATATGGCTTTTCCCGGCGTTTTTCCGATTGTTTTCTTGCTTGTATT
ATCATCGGCGGATCTAGCGGCGAGTCAGTCGCAGCCCGGTCCAACTAATCAACCTTACAACTACGGCAGACTAAGTCCAG
CCATGGCTGTGATCGTTGTCATCCTTATCGCTGCTCTCTTTTTCATGGGCTTCTTCTCCATCTACTTCCGCCACTGTTCC
GGCGTACCTGACGCCGGCGTTTCTCCCGCTGGAGCTGCTAGATCCAGAGGAACCGTCAACGCGGCGGCGCGTGGTCTCGA
CGCTGCAGTTGTCGAGACTTTCCCTACGTTCTTGTACTCGGACGTTAAGACGCAGAAGCTTGGTAAAGGTGAGCTGGAGT
GCGCGATTTGTCTGAACGAGTTCGAAGACGATGAAACGCTGCGTTTGCTTCCCAAGTGTGATCACGTGTTTCACCCTCAC
TGCATCGGTGCTTGGCTCGAGGCTCATGTCACTTGTCCTGTTTGTAGAGCCAATCTTGCTGAACAGGTCGCTGAAGGCGA
ATCGGTTGAACCGGGAGGAACTGAGCCGGATCTTGAACTGCAGCAAGTGGCGCCGAATCCTGAACCGGTACTTACCGCTC
CGGTACCGGAAGAATTGGCGACGAGTGAAATCGATTCGAGGAGATTACCTGGTGTACCGGTGGATCTCAAGCGGGTTAAT
AAGTTCTCGAGATCGCATACAACGGGACATTCAGTGGTTCAACCGGGAGAATGTACCGAGCGGTTTACTCTCCGGTTACC
GGAAGATGTTAGGAAGAGGATAATGAGGGATTGGAAATTGAACCGGTCGAATAGTGTCCTGGTTCTACCTAGGGGAGGGA
GTTCAAGGAGAGGAAAACCGATTGATCGGTCGAGAGCTCGGTCTGACCGGTGGTTGTTCCGGAAAACGCCGTCGTTTCTA
TGGAGGAGTCGTGATGATGGTTCAATAAGGCTAGGTAGTACCGGAAGCGTTCGAGCCAATCCTGTACCGAACCCAACCGG
TGGTGATTCGGTACGAGGAGGAGAACGGTGGGCATTTCTTAGAAACGCGTCGTTTCTGTGGAGGAACTCTTCGGTACATG
TGCAAAGAGGAGGAGTCAATAAAGACGGCGAAGGAACTTCGGTTAATCCAACCGGTCCAAGTGGTTCAAGAAGCGGTTCG
GTGAGATTACCGGTTTAG