Details for Capsella Locus Carubv10013852m

Position : scaf_3 ( 5`- 2982732 .. 2984563 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013852m

Protein [Map View]
MAAAAARPLITVQGLDGDMATDQSSTVVLPDVMTAPVRPDIVNFVHAQMSNNSRQPYAVSKKAGHQTSAESWGTGRAVSR
IPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRINVNMKRHAIVSAIAATAVPSLVMARGHRIENVPEMPLIVS
DSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVYGTEGAKIVKAFRNLPGVELCHVER
LNLLKLAPGGHLGRFVIWTKSAFEKLESIYGSFEKPSEKKKGYVLPRAKMVNADLARIINSDEVQSVVNPIKKDAKRAVL
KKNPLKNLNVMLKLNPYAKTAKRMSLLAEAQRVKAKKEKLAKKRKTVTKEEALAIKAAGKSWYQTMISDSDYTEFDNFTK
WLGASQ*

DNA
ATGGCCGCCGCCGCTGCTCGTCCTCTCATCACCGTCCAAGGTTTGGACGGTGACATGGCCACCGATCAATCCTCCACCGT
CGTATTACCAGACGTCATGACGGCGCCAGTTCGTCCCGACATTGTTAACTTCGTTCACGCGCAAATGTCCAACAATAGCC
GTCAGCCCTATGCCGTGTCCAAGAAGGCTGGTCACCAGACCTCTGCCGAGTCCTGGGGAACCGGACGTGCCGTCTCACGT
ATCCCTCGTGTTCCCGGTGGTGGTACTCACCGTGCTGGTCAAGCAGCGTTCGGTAACATGTGTCGTGGTGGTAGGATGTT
CGCTCCTACCAAGATCTGGCGCCGCTGGCACCGTCGTATCAATGTCAACATGAAGCGTCACGCAATCGTCTCTGCCATCG
CCGCAACTGCAGTTCCTTCGCTTGTGATGGCTCGTGGTCACCGGATCGAGAACGTTCCTGAGATGCCTCTTATTGTGAGT
GACTCCGCCGAAGCTGTGGAGAAGACCTCAGCTGCGATCAAGGTTCTGAAACAAATCGGTGCTTATGATGATGCTGAGAA
AGCCAAGAATAGCATTGGGATCCGTCCTGGTAAAGGTAAAATGAGGAACCGTCGTTACATTTCTAGGAAAGGTCCTCTTG
TGGTTTACGGAACTGAGGGAGCTAAGATAGTTAAGGCGTTTAGGAATCTTCCTGGTGTTGAGCTTTGTCATGTTGAGAGG
CTTAACTTGTTGAAGCTTGCTCCTGGTGGTCACTTGGGTCGTTTTGTTATCTGGACCAAGTCTGCTTTTGAGAAGCTTGA
GTCCATCTATGGCTCATTTGAGAAGCCATCTGAGAAGAAGAAGGGATATGTGCTTCCTCGTGCGAAGATGGTGAATGCTG
ATCTTGCCAGGATTATCAACTCAGACGAGGTTCAGAGTGTTGTGAATCCGATTAAGAAGGATGCCAAGAGGGCTGTTCTT
AAGAAGAATCCATTGAAGAACCTTAATGTGATGTTGAAATTGAATCCGTATGCTAAGACCGCGAAGAGGATGTCACTGTT
GGCTGAAGCACAGAGAGTTAAGGCCAAGAAGGAGAAGCTCGCCAAGAAGAGGAAAACCGTTACCAAGGAGGAGGCTTTGG
CTATCAAAGCAGCAGGCAAGTCGTGGTACCAGACTATGATCTCCGACAGTGATTACACCGAGTTTGATAACTTCACCAAG
TGGCTCGGTGCTAGCCAGTAA