Details for Capsella Locus Carubv10013851m

Position : scaf_3 ( 5`- 5170329 .. 5172808 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013851m

Protein [Map View]
MAGEFLHPPPPSSMRHRSTSEAADGGCGEIVEVQGGHIVRSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQDRLG
FDRPSKAVDWLIKKAKTSIDELAELPPWNPADAIRLAAANAKPRRTSAKTQISPPQQQQPQLQFGVGFDGGGTEHPTNND
NDSSFLPPSMDSDSIADTIKSFFPVVGSSTEAPQNHQLIHNYHHPPDLLSRTNSQNQDLRLSLHSFPDGPPSLLHHHNHT
SASASEPALFYGQSNPLGFDTPSSVSWEQQSSEFGRIQRLVAWNSGATDTGNGGGFLFAPPPSFQPVLGQSQQLYSQRGP
LQSSYSPMIRAWFDPHQHHQSISTDDLNHHHHLPPPVHQSAIPGIGFASGEFSSGFRIPARFQGQEEEQHDGLNHKPSSA
SSISRH*

DNA
ATGGCTGGCGAATTCCTCCACCCGCCGCCTCCTTCTTCAATGAGGCACCGCTCTACGTCCGAGGCGGCTGACGGCGGATG
CGGCGAGATTGTGGAGGTTCAAGGTGGTCACATTGTTCGGTCCACCGGGAGGAAAGATCGGCACAGCAAAGTCTGCACGG
CCAAAGGACCACGTGACCGGCGCGTGAGGCTCTCTGCTCACACGGCGATTCAGTTCTACGATGTTCAAGACCGCCTTGGC
TTCGACCGGCCTAGCAAAGCCGTTGATTGGCTTATCAAAAAGGCTAAGACTTCCATTGACGAGCTCGCTGAGCTTCCTCC
CTGGAATCCCGCCGATGCTATTCGCCTAGCAGCTGCTAACGCTAAACCCAGAAGAACCTCCGCCAAAACCCAAATCTCCC
CGCCTCAGCAGCAACAGCCACAGCTTCAGTTCGGTGTTGGCTTCGACGGAGGAGGAACAGAGCATCCCACTAACAACGAC
AACGACTCGAGTTTTCTTCCGCCGTCTATGGATTCAGATTCGATTGCTGACACTATAAAGTCGTTTTTTCCGGTGGTTGG
TTCTTCGACGGAGGCTCCTCAGAATCATCAGCTTATTCACAACTACCATCATCCGCCGGATTTGCTTTCTCGAACTAATA
GCCAAAACCAAGATCTCCGTCTCTCGCTGCACTCGTTCCCGGATGGTCCACCGTCGCTTCTCCACCACCACAACCACACC
TCTGCTTCCGCCTCCGAACCTGCTCTGTTCTACGGACAGAGCAATCCGTTAGGGTTTGACACACCGAGTTCGGTGAGTTG
GGAGCAGCAGTCATCGGAATTCGGAAGAATTCAGAGACTAGTGGCTTGGAACAGCGGAGCAACCGATACAGGAAACGGAG
GAGGGTTTCTATTCGCTCCTCCTCCGTCGTTTCAGCCAGTCCTTGGCCAAAGCCAGCAGCTTTATTCTCAGAGGGGTCCC
CTTCAGTCCAGTTACAGTCCCATGATCCGTGCTTGGTTTGATCCTCACCAACATCATCAGTCCATCTCCACCGACGATCT
CAACCACCACCATCACCTTCCTCCGCCGGTTCACCAATCAGCAATCCCCGGAATCGGATTTGCCTCCGGTGAATTCTCTT
CCGGTTTTCGCATACCAGCACGGTTTCAGGGACAAGAAGAGGAGCAGCACGACGGTCTCAACCACAAGCCGTCCTCCGCT
TCCTCTATTTCTCGCCATTGA