Details for Capsella Locus Carubv10013850m

Position : scaf_3 ( 5`- 2255475 .. 2258504 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013850m

Protein [Map View]
MDRYKRVDKPKPESPINENEIRITSQGLIRNYISYATSLLQEKGVKDIVLKAMGQAISKTVAISEILKNKIPGLHQDIAI
SSMSITDVWEPMEEGLVPVELTRHVSMISITLSLSELNKDSPGYQAPAQTDQSKPQYQPQQGKQARLPYNAYGEDSYGRG
RGRGRGRGRGRGGYENNQGIYQGKSQGNYQEDYQDIEGGYSNWGRGRGRGGRSYGSRGAGYQGGRGGYSGGRDDGYGGER
NDGYSGGRNDGYSGGRNDGYSGGRNNSYGGGRNNSYGGGRNDGYGGGRNDGYGGGRNDSYSGGRNDGYGGRRGGFRGGRG
GDRGDGYGGGREEGYGVRQGGYEGRGGGRGDGYGGGRGDGYGGGRGDGYEGGRGGYRGVRGGYGRGRGRMGNGGRSRGGA
SNQNQA*

DNA
ATGGATAGATACAAGAGAGTCGACAAACCGAAGCCTGAGTCTCCGATTAACGAGAATGAGATCCGTATCACCAGTCAAGG
CCTTATCCGAAACTACATCAGTTACGCCACCAGCCTTCTTCAGGAGAAAGGTGTGAAAGACATTGTGTTGAAGGCTATGG
GGCAGGCAATCAGCAAGACTGTGGCCATCTCTGAGATACTAAAAAATAAAATTCCAGGTTTGCATCAAGATATTGCAATC
AGTTCTATGAGCATCACTGATGTCTGGGAGCCTATGGAGGAGGGTCTTGTACCGGTTGAGTTGACGCGCCATGTCTCCAT
GATTTCAATTACATTGTCTTTGAGTGAGCTGAATAAAGACTCTCCTGGGTATCAAGCTCCAGCACAGACAGATCAGTCTA
AGCCTCAATATCAGCCACAGCAAGGAAAACAAGCCCGCTTACCGTACAATGCTTATGGTGAAGATTCGTATGGTCGAGGG
AGAGGTCGTGGCAGAGGGAGAGGCAGGGGAAGAGGTGGATATGAAAACAACCAAGGGATTTATCAAGGCAAATCCCAAGG
GAACTATCAAGAAGATTATCAAGACATTGAAGGCGGGTATTCAAACTGGGGCAGAGGCCGTGGACGTGGTGGAAGGAGTT
ATGGCTCTCGTGGTGCTGGATATCAGGGTGGCAGAGGTGGGTATAGTGGTGGGAGAGATGATGGATATGGTGGGGAGAGA
AACGACGGTTACAGTGGAGGTAGAAACGACGGTTACAGTGGAGGTAGAAACGACGGTTACAGTGGGGGCAGAAACAACAG
TTACGGTGGAGGCAGAAACAACAGTTACGGTGGAGGCAGAAACGACGGTTACGGGGGAGGCAGAAACGACGGTTACGGTG
GAGGCAGAAATGACAGTTACAGTGGAGGCAGAAACGATGGGTATGGGGGAAGAAGAGGCGGATTTCGAGGTGGCCGTGGG
GGAGATAGAGGTGATGGGTATGGGGGAGGCAGAGAAGAAGGATATGGTGTACGCCAAGGTGGATATGAAGGGAGAGGCGG
AGGCCGAGGTGATGGGTATGGAGGAGGCCGAGGTGATGGGTATGGAGGAGGCAGAGGTGATGGTTACGAGGGAGGCCGAG
GTGGTTACCGTGGAGTTAGAGGTGGATATGGTCGTGGGCGTGGAAGGATGGGTAATGGTGGCCGTTCAAGGGGTGGTGCT
AGTAACCAGAACCAAGCCTAA