Details for Capsella Locus Carubv10013848m

Position : scaf_3 ( 5`- 9495895 .. 9497425 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013848m

Protein [Map View]
MCELALSSSSEETPNRKKIGFSSLLLSDLHLFCSFIFSHPFYFSYLLFFSPYIFKILSFLSPLFVTTTLLLLALLSTLHS
TCPDSESLETQPSFLFSFFCKLGSVLEHKFEVNDEGFRSLEVLEAYKLVVEACSMELASENEICPDELMFVDKFCSHESK
VSEALTDEEPAEIKPLKFEDLIDLEKEVETKKCEQEEEEEHKVKTKSEAVLDKGEEPTKEESKVQKVDLVGDSNDESNDL
PKLSDFLGEGKRDKVTKKKEEEEDEEEDNVSLQSFGSMRKEKEWRRTLACKLFEERHNADVGQGMDQLWETYETQTEKKE
EDKKKKLKKKTKSMMMKTKSIDHKEVIVEEEDDDVVDHQQLCCLQALKFSTGKMHLGIARPNLLKLSKAFKGIGRFYNAN
KHSKKA*

DNA
ATGTGTGAGTTAGCCTTGTCATCATCTTCAGAAGAGACTCCAAATAGGAAGAAGATTGGTTTCTCTTCTCTTCTCCTCTC
TGACTTACATCTCTTTTGCTCATTCATCTTCTCACACCCTTTCTATTTCTCTTACTTGCTCTTCTTTTCACCTTACATCT
TCAAGATTCTCTCTTTTCTTTCACCACTTTTTGTTACCACCACACTCTTGCTTCTTGCCTTATTGAGTACTTTGCACAGT
ACTTGTCCTGATTCTGAATCATTAGAAACACAACCAAGCTTCCTTTTCTCCTTTTTTTGTAAGCTTGGAAGTGTCTTGGA
ACACAAGTTTGAGGTTAACGATGAGGGTTTTAGGTCCTTGGAAGTGTTGGAAGCGTATAAGCTGGTCGTTGAGGCTTGCT
CTATGGAACTTGCGTCCGAGAATGAGATATGTCCGGATGAATTGATGTTTGTTGACAAATTCTGTAGCCATGAGAGCAAG
GTGTCCGAAGCTTTGACCGATGAGGAGCCAGCTGAGATCAAACCGTTGAAGTTTGAGGATCTGATTGATTTGGAGAAAGA
AGTGGAAACCAAGAAATGTGAACAGGAAGAAGAAGAAGAACATAAAGTCAAAACCAAAAGTGAAGCTGTCCTCGATAAGG
GAGAAGAGCCGACAAAAGAAGAATCCAAAGTTCAAAAAGTTGACCTTGTCGGAGATAGTAATGATGAAAGCAATGATCTC
CCAAAACTAAGCGATTTTCTCGGAGAAGGGAAGAGAGACAAAGTGACTAAGAAGAAGGAAGAAGAAGAAGATGAAGAAGA
AGACAATGTTTCTCTCCAAAGCTTTGGATCAATGAGGAAAGAGAAAGAATGGAGAAGAACATTAGCTTGCAAGCTCTTCG
AAGAACGACACAATGCTGACGTTGGACAAGGCATGGATCAGCTTTGGGAGACTTACGAGACACAAACAGAGAAGAAGGAA
GAAGATAAGAAGAAGAAGCTCAAGAAGAAGACAAAGTCGATGATGATGAAGACAAAGAGTATAGATCATAAGGAAGTAAT
AGTAGAGGAGGAAGATGATGATGTGGTTGATCATCAGCAACTTTGTTGCTTACAGGCTTTGAAGTTCTCAACAGGGAAGA
TGCATTTGGGAATTGCGAGACCTAACCTTCTCAAACTATCCAAGGCTTTCAAAGGCATTGGACGTTTCTACAATGCTAAT
AAGCATTCCAAGAAAGCTTAA