Details for Capsella Locus Carubv10013847m

Position : scaf_3 ( 5`- 2352336 .. 2355401 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013847m

Protein [Map View]
MPDVQSTVVEFVNKLRKRKIEGSQATAKCTVELLRSVISYQRVPHANQAAALIDAVKAVGQQLVAANPVELAVGNVVRRV
LHIIREEDLSLTTAAMAGLDLLDASDDDDVDNCKGIGYPAMSAAVVAAAARSTLRPPSLQTLLEGTPESATVPYTSSSGA
DSESKTADKSSLTRKLKHDVIEGVNQLIHEIAGCHEQIAEQAIEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVFVA
EGAPRYQGHLLAKELVARGLQTTVITDSAVFAMISRVNMVIIGAHAVMANGGVIGPVGVNMAALAAKKHAVPFVVLAGSH
KLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDSGAGSGSLQVVNPTFDYVPPNLVSLFITDTGGHNPSYMYRLIADYY
SADDLVM*

DNA
ATGCCGGACGTACAATCAACGGTGGTGGAGTTTGTAAACAAGCTCAGGAAGCGTAAGATTGAGGGCTCACAGGCTACCGC
CAAATGCACTGTAGAGCTTCTTAGGTCAGTAATTTCGTATCAGCGAGTGCCTCACGCAAACCAGGCCGCTGCTCTTATTG
ATGCTGTGAAAGCCGTTGGTCAGCAATTGGTAGCTGCAAATCCAGTTGAGCTTGCGGTGGGAAATGTAGTTAGACGGGTT
TTGCATATTATAAGGGAGGAGGATCTTTCCCTCACTACAGCAGCTATGGCGGGTTTGGACTTGTTGGATGCAAGTGATGA
TGATGATGTAGATAACTGCAAAGGAATTGGGTATCCTGCAATGTCTGCAGCAGTTGTTGCAGCTGCAGCTAGGAGTACGT
TACGCCCTCCATCTTTGCAAACGCTACTCGAGGGCACTCCTGAATCTGCAACTGTCCCATACACATCTTCATCCGGTGCT
GATTCCGAAAGCAAAACTGCCGATAAAAGTTCATTAACTCGGAAGCTAAAGCATGATGTTATCGAAGGAGTGAATCAACT
TATTCATGAGATTGCTGGTTGTCATGAGCAGATTGCTGAGCAAGCTATAGAGCATATACATCAAAATGAGGTGATCCTAA
CCCTGGGTAGCTCAAGAACAGTGCTTGAGTTTCTGTGTGCTGCAAAGGAGAAAAAAAGATCTTTTCGTGTATTTGTCGCC
GAAGGTGCTCCAAGGTATCAGGGCCATCTATTAGCAAAAGAACTGGTAGCTAGAGGTTTGCAGACCACAGTGATTACCGA
CTCTGCAGTGTTTGCTATGATATCTCGAGTGAATATGGTTATAATTGGAGCCCATGCAGTGATGGCTAATGGTGGGGTTA
TAGGACCTGTTGGTGTCAACATGGCTGCTCTTGCAGCAAAAAAGCACGCAGTCCCATTTGTGGTTCTAGCCGGTAGTCAC
AAGTTGTGTCCACTCTATCCACACAATCCGGAGGTATTACTAAATGAGCTGAGATCTCCATCTGAACTGTTGGATTTTGG
TGAATTCTCGGATTGCCTGGACTCTGGAGCGGGTTCCGGGTCTCTTCAAGTTGTCAACCCAACATTCGATTATGTCCCAC
CAAACCTTGTCAGTCTCTTCATAACGGATACGGGAGGACACAATCCATCTTACATGTACCGCCTTATTGCTGACTATTAC
TCTGCTGATGATTTGGTGATGTAG