Details for Capsella Locus Carubv10013846m

Position : scaf_3 ( 5`- 830158 .. 833091 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013846m

Protein [Map View]
MDLAGEPNSLISAVASSSSSSVSSIDTSLDCDSPRGGDVDHELLNHTAVPSSSSVSVSSSSSASVQRVLSLIRSEDLGSR
LFAAREIRRLTKTSHRCRRHFSQAVEPLVSMLRFDSPESHHEAALLALLNLAVKDEKNKVSIIEAGALEPIINFLQSNSP
TLQEYASASLLTLSASASNKPIIGANGVIPLLVKVIKHGSPQAKADAVMALSNLSTLSDNLSMILATKPLSPILNLLISS
KKSSKTSEKCCSLIESLMVSGEEPRSGLISNEGGVLAVVEVLENGSLQAREHAVGVLLTLCQSDRSKYREPILREGVIPG
LLELTVQGTSKSRIKAQRLLCLLRDSESPRSEVQPDTIENIVSSLISHIDGDDQSGKAKKMLAEMVQVSMEKSLRHLQER
ASTLVRP*

DNA
ATGGACCTCGCCGGAGAACCAAACAGCCTCATCTCCGCCGTCGCTTCTTCTTCCTCTTCCTCCGTTTCATCAATCGACAC
GAGCCTCGATTGCGATTCGCCACGTGGCGGAGATGTAGACCACGAATTGCTCAACCACACGGCGGTTCCGTCGTCGTCGT
CGGTGTCGGTTTCTTCGTCTTCCTCTGCTTCAGTCCAGAGAGTCCTCAGTTTAATCCGATCGGAGGATCTAGGTTCGAGG
CTGTTTGCTGCCAGAGAGATCCGTCGGCTAACGAAGACGTCTCACAGGTGCCGCCGACACTTTTCCCAAGCCGTCGAACC
TCTCGTTTCGATGCTCCGATTTGATTCCCCTGAATCGCACCACGAGGCTGCTCTGCTTGCTCTCCTTAACCTCGCCGTCA
AAGACGAGAAGAATAAAGTGAGTATAATTGAAGCCGGTGCTTTAGAGCCAATCATCAACTTCTTACAATCAAACAGCCCA
ACACTTCAAGAGTATGCCTCTGCATCTTTGCTCACTCTCTCTGCGTCAGCAAGCAACAAACCCATCATTGGAGCTAATGG
CGTAATTCCTTTATTAGTCAAAGTCATTAAGCATGGAAGCCCACAAGCTAAAGCTGATGCAGTTATGGCCCTTTCCAACC
TCTCTACGCTCTCTGATAACCTAAGCATGATCCTAGCGACTAAACCACTCTCACCCATTCTGAATCTTCTCATATCAAGT
AAAAAGTCATCCAAAACATCTGAGAAATGTTGTTCTCTGATAGAATCCTTGATGGTTTCTGGCGAGGAGCCGAGATCAGG
GTTAATTTCTAACGAAGGGGGAGTTTTAGCGGTCGTGGAAGTTCTTGAAAATGGTTCATTACAAGCACGGGAACACGCAG
TTGGCGTGCTTTTAACGTTGTGCCAAAGCGATAGGAGTAAATACAGAGAGCCAATTCTCAGAGAAGGTGTGATACCGGGA
CTGCTTGAGCTCACGGTTCAAGGGACATCGAAATCTCGGATTAAAGCTCAAAGACTTCTGTGTCTGCTAAGGGACTCGGA
AAGCCCGAGATCAGAGGTACAACCCGACACAATAGAGAACATAGTGTCAAGCTTAATCTCTCATATAGACGGAGATGATC
AATCCGGTAAGGCAAAGAAGATGCTAGCTGAAATGGTGCAAGTTAGCATGGAAAAAAGTTTGAGACATCTACAAGAACGT
GCTTCCACTCTTGTCCGTCCTTAA