Details for Capsella Locus Carubv10013843m

Position : scaf_3 ( 5`- 1392409 .. 1394979 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013843m

Protein [Map View]
KLSTIGETRMAVQWLLVCHGMVTLTVVISFLCGQWPIFKGTPFQWIHYFITFGAYDYFLRFVGLVFGSKGTDVIMSVEYF
CCERPNPVLQVIYVAIMGSTYFLTAKSSFIYIPGYYIGDVHKYASFLAVIIGVILFLLTSFSDPGTVNAENVSRYISAYP
YDDIIYSEKDCSTCKIPKPARSKHCSICNRCVARFDHHCGWMNNCIGERNTKYFMAFLFWHFLLCLYGTIAIGFILAGRV
KELRVVHILTVYYGVDKSFRSLAPRVLQWLVGTYNTQILLMVFLAIVSLLLAGFFAYHAKLCLTNTTTNETFKWREYLVL
KKKFSEAKASAAALKAGMSCEQKKPLTKGKCFGLCGRSSAHEEAEAKTEAIAKLNLYDRGSFQNVSEIVFPLSSRPSSSS
KSKLKPE*

DNA
AAACTTTCCACGATCGGAGAGACGAGAATGGCGGTACAGTGGCTTCTGGTGTGTCATGGGATGGTGACGCTAACGGTGGT
CATCTCCTTCCTCTGTGGTCAATGGCCCATCTTCAAAGGCACACCTTTTCAGTGGATTCATTACTTCATCACTTTCGGCG
CCTACGATTACTTCCTGAGATTTGTGGGATTGGTGTTCGGTTCCAAGGGAACGGACGTGATTATGTCTGTGGAGTATTTC
TGTTGCGAGCGTCCTAATCCTGTTCTGCAGGTGATTTATGTAGCCATTATGGGATCAACTTACTTCTTAACTGCAAAATC
TTCATTCATCTATATACCTGGATATTATATTGGCGATGTTCACAAGTACGCGAGCTTTCTGGCTGTTATAATTGGTGTCA
TACTTTTCTTGTTGACAAGCTTTTCTGATCCAGGTACTGTGAACGCTGAGAATGTTTCACGGTACATTTCTGCTTACCCC
TATGATGATATCATTTACTCGGAGAAAGATTGTTCTACGTGTAAAATCCCAAAGCCTGCTAGATCCAAGCATTGCAGCAT
CTGCAACCGCTGTGTGGCTCGGTTTGACCATCATTGTGGGTGGATGAATAATTGTATAGGCGAAAGGAATACCAAATATT
TCATGGCTTTCCTCTTTTGGCATTTCCTTCTTTGCTTGTACGGAACAATAGCCATTGGGTTTATTCTCGCTGGGCGAGTA
AAAGAACTTCGTGTTGTACATATTTTAACCGTCTATTACGGCGTAGATAAATCTTTCCGTAGCTTAGCTCCTCGAGTTTT
ACAGTGGCTAGTTGGTACATACAACACCCAGATTCTCCTAATGGTGTTTCTCGCCATTGTTTCTCTCCTCCTTGCTGGCT
TCTTCGCTTACCACGCAAAACTCTGCTTAACCAACACAACAACTAATGAGACATTTAAGTGGAGAGAATATCTAGTCTTG
AAGAAGAAGTTCAGTGAAGCAAAGGCGAGCGCTGCTGCTCTCAAGGCAGGAATGTCATGTGAACAGAAGAAGCCATTAAC
AAAAGGAAAATGCTTTGGGCTCTGTGGGAGATCCTCTGCTCATGAGGAAGCAGAGGCCAAAACCGAAGCTATAGCGAAAC
TGAATTTGTATGACAGAGGAAGTTTCCAAAACGTTTCTGAGATTGTTTTCCCTTTATCGTCAAGACCATCTTCTTCCAGC
AAATCAAAACTGAAACCGGAATAG