Details for Capsella Locus Carubv10013842m

Position : scaf_3 ( 5`- 474775 .. 477388 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013842m

Protein [Map View]
MDIGEIIGEVAPPVSIPTKSAIYVWGYNQSGQTGRKGHEKLLRIPKQLPPELFGCPAGANSRWLDISCGREHTAAVASDG
SLFTWGANEYGQLGDGTEVGRKHPKKVKQLQSEFVKFVSCGAFCTAAIAEPRDNDGTLSTSRLWVWGQNQGSNLPRLFSG
AFPVTTAIRQVSCGTAHVVALSEEGLLQAWGYNEQGQLGRGVTCEGLQAPRVITAYAKFLDEAPELVKIMQVSCGEYHTA
AVSDTGEVYTWGLGSMGQLGHVSLQSEDKELIPRRVNGLDGVSMKEVACGGVHTCALSLEGALYAWGGGQAGQLGLGPQS
VFLFKVSNGSEMLLRNVPVLVIPTDVRLVACGHSHTLVYMREGRICGWGYNSYGQAANEKSSYAWYPSPVDWTSEEASSR
RWSFGCFN*

DNA
ATGGATATTGGAGAAATCATTGGTGAAGTAGCTCCACCTGTGAGTATCCCAACAAAGAGCGCAATATACGTTTGGGGTTA
CAATCAAAGCGGACAAACTGGTAGGAAGGGACACGAGAAGCTTTTGCGTATCCCAAAACAGCTTCCTCCTGAGCTTTTTG
GTTGCCCCGCTGGTGCGAATTCCCGTTGGCTCGATATATCTTGTGGTCGGGAACATACAGCTGCCGTTGCATCAGATGGA
TCTCTCTTTACTTGGGGTGCTAATGAATATGGTCAGCTTGGGGATGGAACCGAGGTTGGGAGGAAACATCCAAAGAAGGT
TAAGCAGCTGCAATCAGAATTTGTGAAATTTGTGTCTTGTGGAGCTTTTTGCACTGCAGCTATAGCAGAACCCCGTGACA
ATGACGGTACTCTTTCCACTAGTAGACTATGGGTTTGGGGCCAAAACCAGGGATCAAATTTACCACGCTTGTTTTCTGGG
GCATTTCCTGTTACAACGGCGATCCGCCAAGTATCCTGTGGGACAGCTCATGTTGTGGCCTTATCAGAAGAAGGCCTTCT
TCAAGCTTGGGGCTATAATGAACAAGGCCAACTTGGTAGAGGAGTCACTTGTGAAGGACTACAAGCACCTCGTGTGATAA
CTGCTTATGCGAAGTTCCTTGATGAAGCACCTGAGCTTGTGAAGATTATGCAAGTTTCATGTGGGGAATACCATACTGCT
GCTGTATCTGATACAGGCGAGGTTTATACTTGGGGATTAGGAAGCATGGGTCAACTTGGGCATGTTTCTCTTCAGTCCGA
GGATAAGGAGTTAATACCAAGACGAGTCAATGGTCTTGATGGTGTGTCAATGAAAGAAGTTGCTTGTGGTGGTGTACACA
CTTGTGCTTTATCTTTGGAAGGAGCACTTTATGCTTGGGGTGGTGGCCAAGCAGGACAGCTAGGACTTGGTCCTCAATCT
GTTTTTTTGTTTAAAGTCTCTAATGGAAGCGAAATGCTTCTACGAAATGTCCCTGTTTTAGTCATCCCAACTGATGTCCG
GCTTGTTGCTTGTGGACATTCTCACACGCTCGTTTATATGAGAGAGGGACGCATTTGCGGATGGGGTTATAATAGCTATG
GTCAAGCAGCAAATGAGAAATCGTCATATGCTTGGTACCCATCGCCTGTAGACTGGACAAGTGAGGAAGCTAGCAGCAGG
AGGTGGTCATTCGGCTGTTTTAACTGA