Details for Capsella Locus Carubv10013841m

Position : scaf_3 ( 5`- 6391204 .. 6393223 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013841m

Protein [Map View]
MFSIVSSSSSLVNSSSTLFHNSSKSPIRVMSAASGFKTLTENFTVRVQKAENRELNVPLISPFTIASSRLDSVSNVAIRI
ELGDGCVGWGEAPILPSVTAEDQITAMVKAREACEFLRELPEMKLGSVLHEIGRLLPGHRFASVRAGMEMAMIDAAAKSV
GVPLWKLFGGASSTITTDITIPIVSPAEASILALKYRKQGFETLKLKVGKNLKADIEVLQAIRAVHPTCSFILDANEGYK
TEEAVEVLEKLHEMKVTPVLFEQPVHRDNWEGLSHVTRTAKSRFGVSVAADESCRDLTDLKKIIEGGIVDVVNIKLAKTG
ILEALEVIELAMSSGIELMIGGMVETRLAMGFSGHLAAGIGSFRFIDLDTPLLLADDPVLGGYKASGAVYEFTDEGGHGG
YLQWNDLA*

DNA
ATGTTTTCGATAGTATCTTCTTCTTCTTCACTCGTCAATTCAAGTTCAACCCTTTTCCACAATTCGTCGAAATCTCCGAT
CCGTGTTATGTCGGCGGCGTCTGGGTTCAAAACCCTGACGGAGAATTTCACCGTAAGGGTGCAGAAAGCAGAGAATCGAG
AGCTGAACGTGCCTCTGATCTCACCCTTCACTATCGCTTCCTCACGGCTTGATTCAGTGAGTAATGTTGCGATTCGGATT
GAGCTTGGAGATGGGTGTGTCGGCTGGGGAGAAGCTCCGATTTTGCCGTCGGTTACGGCGGAGGATCAGATTACGGCAAT
GGTGAAAGCGCGGGAAGCTTGTGAGTTTCTGAGGGAGTTACCTGAGATGAAACTTGGTAGTGTTCTTCATGAGATCGGGA
GGCTTCTCCCTGGTCATCGATTTGCCTCTGTAAGAGCTGGGATGGAGATGGCTATGATTGATGCCGCAGCTAAGAGTGTA
GGAGTGCCGTTGTGGAAACTATTTGGTGGAGCTTCGAGTACTATTACCACCGACATAACAATTCCGATAGTTTCTCCAGC
CGAAGCTTCGATTTTGGCTCTGAAGTATAGAAAACAAGGTTTTGAAACCTTGAAGCTCAAGGTGGGGAAGAATCTTAAGG
CTGACATAGAGGTTCTCCAGGCCATACGTGCAGTCCACCCTACTTGTTCCTTCATTTTGGATGCCAATGAGGGTTATAAA
ACAGAGGAAGCTGTTGAAGTTCTCGAGAAGCTTCATGAGATGAAGGTTACACCGGTTCTCTTTGAACAACCCGTCCACAG
AGACAATTGGGAAGGTCTCAGTCACGTGACTCGAACTGCAAAGAGCAGATTCGGAGTCTCTGTTGCAGCAGATGAGAGTT
GCAGAGACTTGACTGATCTCAAGAAAATCATAGAAGGTGGTATCGTAGATGTTGTTAACATCAAACTCGCCAAAACCGGA
ATCCTCGAGGCCCTCGAAGTAATTGAATTAGCTATGTCATCTGGAATTGAGCTTATGATAGGGGGAATGGTTGAGACAAG
ACTAGCAATGGGGTTCTCTGGTCACCTTGCTGCAGGCATTGGGAGTTTCAGATTCATCGACTTAGATACTCCACTTCTTC
TGGCTGACGATCCTGTTCTAGGTGGCTACAAAGCATCGGGTGCTGTCTACGAGTTTACAGATGAAGGCGGTCACGGAGGA
TATCTTCAATGGAATGATCTCGCTTAG