Details for Capsella Locus Carubv10013835m

Position : scaf_3 ( 5`- 2804634 .. 2806074 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013835m

Protein [Map View]
MDHEVTKKITAMFDNRRLNRSGSSLFTAFASTVIALVIFTIVLVSNLSVRDYSAKLVTIEIKTVVPYLPLSLEKELSEDT
NSNYSTKQQITVKEVNNLHVIDVFGGKGLSEKFQQRATEFLRDDCEVNFMMTWISPAESFGKREVLSVESVFKSHPRGCL
IILSSTMDSPQGFRILKPFLDRGYRVMAVTPDLPFLLKGTAGESWLEEIQTGKRDPGKVPLPQNLSNLMRLAYLFKFGGV
YLDTDMIVLKSFKTLRNVIGAQTLEPVSRNWTRLNNAVLVFDKNHPFLLKTIEEFALTFNGNVWGHNGPYLVSRVARAVE
GTTGYNFSIMTPPAFYPVNWIEIEKLFKVARTEKDSKRVQVKVLEMQKRSYGLHLWNKFSSKFEIEQGSAMDKLVSDHCL
ICDSVVSVS*

DNA
ATGGATCACGAAGTCACTAAGAAAATCACGGCCATGTTTGATAACCGGCGGTTAAACCGCTCCGGATCATCACTGTTCAC
AGCGTTTGCTTCCACAGTAATAGCTCTGGTCATTTTCACGATCGTTCTCGTCTCTAATCTATCGGTGAGGGATTACTCGG
CCAAGTTGGTGACGATAGAGATCAAGACAGTTGTTCCTTACTTACCTCTAAGCTTAGAGAAGGAGCTAAGTGAAGACACC
AACAGTAACTATTCTACCAAGCAACAAATCACAGTCAAAGAGGTTAACAATCTTCATGTTATTGATGTTTTTGGAGGCAA
AGGCCTGTCTGAGAAGTTTCAACAGAGAGCAACAGAGTTTTTGAGAGATGATTGTGAGGTCAACTTCATGATGACATGGA
TCTCACCTGCGGAGTCGTTCGGTAAGAGAGAGGTTTTGTCCGTGGAAAGCGTCTTTAAATCTCATCCTCGAGGTTGTTTG
ATCATTTTATCATCAACAATGGATTCTCCTCAAGGGTTCAGAATCTTGAAACCGTTTCTTGATCGTGGTTACAGAGTTAT
GGCGGTCACCCCGGATTTGCCTTTTCTTCTCAAAGGCACAGCCGGAGAATCGTGGCTTGAAGAGATTCAAACCGGTAAAA
GAGATCCTGGAAAGGTTCCTCTACCTCAGAATCTGTCAAATCTCATGAGACTGGCGTATCTGTTCAAATTCGGAGGTGTT
TATTTGGACACAGACATGATTGTTCTCAAGAGCTTTAAAACTCTTAGGAACGTGATCGGTGCACAGACCCTCGAACCGGT
TTCGAGAAACTGGACGAGACTGAACAATGCGGTTCTGGTCTTCGACAAGAACCACCCTTTCTTGCTCAAAACCATTGAAG
AATTCGCGTTGACTTTCAATGGAAACGTTTGGGGACATAACGGACCGTATCTTGTTTCTCGAGTGGCTCGAGCCGTGGAA
GGAACCACTGGTTATAACTTCTCCATCATGACACCTCCTGCGTTTTATCCAGTGAACTGGATTGAGATTGAGAAACTATT
CAAAGTTGCAAGAACAGAGAAAGATTCGAAGAGAGTCCAAGTCAAGGTTCTTGAGATGCAGAAGAGAAGCTACGGGTTGC
ATCTGTGGAATAAGTTTAGCAGCAAATTCGAAATTGAACAAGGCAGTGCCATGGATAAATTGGTTTCAGATCACTGTCTA
ATCTGTGACAGTGTTGTCTCTGTATCGTAA