Details for Capsella Locus Carubv10013833m

Position : scaf_3 ( 5`- 1902617 .. 1906398 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013833m

Protein [Map View]
MACCLASCCASATCGLCSSVASGISRKSARIAYCGLFGASLVVSWILRETGAPLLEKLPWINTSDSYTTEWYQQQAVLRV
SFGNFLFFAIYALIMIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSIYGTLSKFGAGAFLLVQVVLLLDA
THNWNDSWVEKDEKKWYIALLVISIVCYIATYAFSGILFIWFNPSGHDCGLNVFFIVMPMILAFVFAIIALHPAVNGSLL
PASVISVYCAYVCYTGLSSEPHDYVCNGLNKSKAVNASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRSGGREALL
EDPEDGKKKGGEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDSSESASLIDVGWTSVWVKICTGWVTAGLYIWTLIA
PLILPDREFY*

DNA
ATGGCGTGTTGCTTAGCTTCGTGCTGTGCGTCGGCGACTTGTGGGTTGTGCTCATCGGTGGCGTCGGGGATCTCGAGGAA
ATCAGCGAGGATCGCTTATTGTGGTCTCTTCGGTGCTTCTCTTGTCGTCTCCTGGATTCTTCGCGAGACTGGTGCTCCGC
TCCTTGAGAAACTCCCTTGGATAAATACTTCCGATTCATATACCACAGAATGGTATCAGCAGCAAGCTGTTCTTCGTGTG
AGCTTTGGGAATTTCCTCTTCTTTGCGATATATGCTTTGATCATGATCGGTGTGAAGGACCAGAACGACAGGCGTGACTC
GTGGCACCATGGCGGATGGGGTTTGAAGATGATTGTATGGTTTTTGCTTGTTGTCCTCATGTTTTTTGTTCCAAATGTTA
TCGTCTCAATCTATGGAACTTTATCAAAATTTGGTGCTGGAGCGTTTCTGTTGGTTCAAGTGGTCTTGTTGTTAGATGCT
ACACATAACTGGAATGATTCATGGGTCGAAAAGGATGAAAAGAAATGGTACATTGCTCTGCTTGTCATATCAATTGTGTG
TTACATTGCTACATACGCCTTCTCAGGAATCCTGTTCATCTGGTTCAACCCATCTGGTCATGATTGTGGACTAAATGTTT
TCTTCATCGTCATGCCGATGATCCTGGCCTTTGTTTTTGCTATTATTGCGTTACATCCTGCGGTGAATGGCAGTCTTTTA
CCGGCGTCAGTTATTTCGGTTTACTGTGCTTATGTCTGTTACACGGGTCTATCTAGCGAACCACATGATTATGTGTGCAA
TGGACTTAACAAATCCAAGGCAGTGAACGCAAGTACTCTCATCCTTGGAATGCTCACCACGGTTCTCTCGGTCCTATACT
CCGCCCTCCGAGCTGGCTCTTCCACCACGTTCCTCTCACCACCGTCTTCTCCTAGATCTGGTGGGAGAGAGGCATTGTTA
GAGGATCCAGAGGACGGGAAGAAGAAGGGTGGTGAAGCCGAGGCGCGGCCTGTGAGCTACTCGTACTCCTTCTTCCATAT
AATATTTGCTCTTGCGAGCATGTACGCTGCAATGCTTCTATCGGGATGGACTGATTCCTCAGAGAGTGCATCTCTGATCG
ATGTGGGATGGACCTCGGTGTGGGTCAAGATATGCACCGGTTGGGTCACGGCGGGACTATACATCTGGACACTCATCGCA
CCGCTCATCCTTCCGGATCGTGAGTTCTACTAA