Details for Capsella Locus Carubv10013830m

Position : scaf_3 ( 5`- 9170942 .. 9174827 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013830m

Protein [Map View]
METGTSVSNNNDRSINDSYEAIKNGSWFNQFRNGCNPWMARYVYGLIFLISNLLAWGARDYGRRALREVTIFKNCKGGEN
CLGTEGVLRVSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFVKLILWPALTIIPFLLPSSIIHLYGEIAHFGAGVFL
LIQLISVISFIQWLNECYQSQKDTEKCRVYVMLLATTSYTVCIVGVILMYVWYAPDASCLLNIFFITWTLFLIQLMTSIA
LHPKVNAGYLTPALMGLYVVFVCWCAIRSEPVGESCNRKAAASNRTDWLTIISFMVALLSMVIATFSTGIDSQCFQFKKN
GKDQEEEEEREDSVPYGYGFFHFVFATGAMYIAMLLIGWNTHHPMKKWTIDVGWTSTWVRVVNEWLAACVYIWMLVSPLI
LKSRRQTTNGTT*

DNA
ATGGAGACCGGTACAAGCGTTAGCAACAACAATGATAGAAGTATAAACGATAGCTATGAAGCAATCAAGAATGGATCATG
GTTTAATCAGTTCCGCAATGGCTGCAATCCATGGATGGCTAGATATGTATATGGTCTTATCTTCCTCATCTCGAATCTAC
TAGCTTGGGGTGCTCGTGATTATGGTCGGCGTGCCTTAAGAGAAGTAACAATATTTAAGAACTGTAAAGGTGGAGAAAAC
TGTTTGGGGACAGAAGGAGTCTTGAGGGTTAGCTTGGGATGTTTTTTGTTCTACTTTGTTATGTTTCTTTCAACACTTGG
CACGTCGAAAACGCATTCTTCAAGAGATAGATGGCATTCTGGATGGTGGTTTGTTAAACTCATCTTGTGGCCTGCTTTAA
CCATCATCCCCTTCTTGCTTCCTTCTTCCATTATTCACCTTTACGGAGAGATAGCCCATTTTGGTGCAGGGGTATTTCTC
TTAATACAACTAATTAGTGTGATCAGTTTCATTCAATGGCTTAACGAATGCTATCAGTCTCAAAAAGATACAGAAAAATG
CCGTGTCTATGTGATGCTACTAGCAACTACATCATACACAGTGTGTATAGTAGGAGTGATTTTGATGTACGTTTGGTATG
CTCCTGATGCTTCATGTCTTCTCAATATATTCTTTATAACTTGGACTTTGTTCCTCATCCAACTCATGACAAGCATAGCT
CTCCATCCTAAAGTGAATGCTGGATACTTGACTCCAGCTCTTATGGGACTCTATGTTGTTTTTGTATGCTGGTGCGCTAT
TCGAAGTGAACCAGTGGGAGAAAGTTGCAATAGAAAAGCAGCAGCTTCGAACAGAACAGATTGGCTTACCATAATTAGCT
TTATGGTTGCACTACTTTCAATGGTTATCGCGACGTTTTCAACAGGAATAGATTCTCAATGTTTCCAGTTCAAGAAAAAT
GGGAAAGATCAAGAAGAAGAAGAGGAAAGGGAAGATAGTGTTCCATATGGATATGGATTCTTCCATTTTGTGTTTGCCAC
AGGAGCAATGTACATAGCTATGTTACTCATTGGATGGAACACTCATCACCCTATGAAAAAGTGGACGATTGATGTGGGAT
GGACAAGTACTTGGGTAAGAGTTGTGAACGAGTGGCTTGCTGCTTGCGTGTACATTTGGATGTTGGTGTCTCCACTCATA
CTAAAGAGCAGAAGACAAACGACAAATGGGACGACGTAA