Details for Capsella Locus Carubv10013819m

Position : scaf_3 ( 5`- 8225555 .. 8228322 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013819m

Protein [Map View]
MDPLSVLKDFTVRGDVDKIERVGANYRFGSEYSFPCATETAYRSKGGTLYTLEALVHYAKNQHLKHGEYMQSTVKSSVPA
VTLPDRKPLLDYLTGRVASSDSIDYLLLQQQNAQSQKQNEEYRPDQDNSAFVSRESAIEDMEVEDFGKSGEDVDYIMLIR
SNERPLKSRDAILQCKNRDFYSVLVNSTKREEERQRIESHQRKDGLVAKSRLMGAEERGIVGFSGGGDDNGYDANPKSKL
HFKAGKIGEGVPIILVPSASQTLITIYNVKEFLEDGVFIESDVKAKEMKGLKPDCITVQKKFSRDRERVVTAYEVRDKPS
ALKPDDWDRVVAVFVLGKDWQFKGWPFKDHVEIFNKIIGFFMRFADDSIESAKTVKQWNVKIISISKNKRHHDRTAALEV
WEKLEEFVRSRSHS*

DNA
ATGGATCCGTTATCAGTGCTGAAGGACTTCACAGTACGAGGAGACGTTGATAAAATCGAGCGAGTCGGAGCCAATTACAG
ATTCGGATCGGAATATTCGTTCCCATGCGCGACGGAGACGGCGTACAGATCAAAAGGTGGGACTCTCTACACGCTAGAAG
CACTGGTTCACTATGCGAAGAATCAGCATCTGAAACACGGAGAGTATATGCAATCAACCGTTAAAAGCTCCGTCCCGGCG
GTGACTTTACCAGATCGGAAACCTCTCCTCGATTACCTCACCGGGAGAGTAGCTTCTTCTGATTCGATTGATTATCTATT
GCTCCAGCAGCAAAACGCACAGAGTCAGAAGCAGAACGAAGAGTATCGACCAGATCAAGACAATTCAGCTTTTGTTTCTA
GGGAGAGCGCGATTGAGGATATGGAGGTTGAAGATTTCGGTAAATCCGGCGAGGATGTTGATTACATTATGCTGATTCGA
TCCAATGAACGGCCGTTGAAGAGCAGAGACGCGATTCTTCAGTGTAAGAATAGGGATTTTTATAGTGTGTTGGTGAATTC
GACTAAGAGGGAAGAAGAGAGACAGAGGATTGAGTCTCATCAAAGGAAAGATGGATTAGTTGCTAAGAGTAGGTTAATGG
GTGCTGAAGAGAGAGGTATTGTAGGGTTTAGTGGCGGTGGAGATGATAATGGCTATGATGCTAATCCTAAATCTAAGCTT
CATTTTAAAGCTGGGAAGATTGGAGAAGGTGTCCCGATAATTCTTGTGCCAAGTGCGTCTCAGACTTTGATTACCATATA
TAATGTTAAAGAGTTTCTTGAAGATGGAGTTTTTATAGAGAGTGATGTTAAGGCTAAGGAGATGAAGGGGTTAAAGCCTG
ATTGTATTACGGTTCAGAAGAAGTTTAGTCGAGATAGAGAGAGAGTTGTGACTGCTTATGAAGTTAGGGATAAGCCATCT
GCCTTGAAGCCTGATGATTGGGATCGTGTTGTTGCGGTTTTCGTATTGGGAAAAGATTGGCAGTTCAAGGGTTGGCCTTT
CAAGGATCACGTTGAGATATTCAATAAGATCATTGGGTTCTTCATGCGGTTTGCAGATGACAGTATCGAATCAGCCAAGA
CAGTGAAGCAGTGGAATGTAAAGATTATCTCGATTAGCAAGAATAAGAGGCATCATGACCGGACTGCTGCATTAGAAGTC
TGGGAAAAACTCGAGGAGTTTGTGCGATCTCGGTCACATTCTTAA