Details for Capsella Locus Carubv10013818m

Position : scaf_3 ( 5`- 9534558 .. 9536230 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013818m

Protein [Map View]
NAINPTIWYHLRTGHTGELAFPEHFRSYTISDFSFRTMSATLRRLILLSSANRVCILSPTCLSTAVNRHLSLSFSSSPET
HTSLSRTRTRTPLETQFETWIQNLKPGFTNSDVVTALRAQSDPDLALDIFRWTAQQRGYKHNHEAYHAMIKQAITGKRNK
FVETLIEEVIAGACEISVPLYNCIIRFCCGRKFLFNRAFDVYNKMLRSDNSKPDLETYTLLLSSLLKRFNKLNVCYVYLH
AVRSLTKQMKSNGVIPDTYVLNMIIKAYAKCLEVDEAIRVFREMALYGSEPNAYTYSYLIKGLCEKERLGQGLGFYKEMR
SKGMVPNGSCYMVLICSLSMERRLNEAVEVVYDMLANSLSPDMLTYNTVLTELCRGGRGNEALELVEEWKKRDPVMGERN
YRTLMDEVYFLNKG*

DNA
AATGCGATAAACCCTACTATTTGGTATCATCTTCGAACCGGCCACACCGGAGAATTAGCTTTCCCCGAGCACTTTAGAAG
CTACACAATATCGGACTTTTCGTTCCGTACAATGTCGGCGACACTCCGACGCCTCATCCTTCTCTCCTCCGCTAATCGCG
TTTGTATTTTATCTCCGACGTGTCTGTCCACCGCCGTGAATCGCCACCTATCTCTGTCTTTCTCTTCTTCGCCGGAAACA
CACACCTCCCTTTCCCGGACTCGAACCAGAACACCACTCGAGACTCAATTCGAAACATGGATCCAGAATCTCAAACCAGG
ATTCACAAACTCAGACGTTGTAACAGCCTTACGAGCTCAATCTGATCCAGATCTGGCGCTCGACATCTTCCGATGGACGG
CTCAGCAACGAGGCTACAAACACAATCACGAAGCTTACCACGCCATGATCAAACAAGCAATCACCGGAAAACGAAACAAA
TTCGTCGAAACCTTAATCGAAGAAGTAATCGCCGGCGCTTGTGAAATCAGCGTTCCTCTCTACAATTGCATCATCAGATT
CTGCTGTGGTCGTAAGTTTCTCTTCAATCGAGCTTTCGATGTTTATAACAAGATGCTTCGATCTGATAACTCGAAACCTG
ATCTTGAAACTTACACTTTGCTTCTCTCTTCATTGCTGAAGAGATTCAACAAATTGAATGTTTGTTATGTGTATCTTCAC
GCTGTTAGATCGCTCACGAAGCAGATGAAATCGAACGGTGTGATTCCGGATACGTATGTGTTGAATATGATAATCAAAGC
TTATGCAAAGTGTCTTGAAGTAGATGAAGCTATAAGGGTGTTTAGAGAGATGGCTCTGTATGGCTCTGAGCCTAATGCTT
ATACTTATAGTTACTTAATTAAAGGGCTTTGTGAGAAAGAAAGGCTTGGACAGGGTTTAGGGTTTTACAAGGAGATGAGG
AGTAAAGGGATGGTTCCTAATGGGAGTTGTTATATGGTTTTGATTTGTAGTCTTTCAATGGAGAGGAGATTGAATGAAGC
AGTCGAAGTTGTGTATGACATGTTGGCGAATTCGTTGTCTCCGGATATGTTGACGTATAATACAGTTTTGACTGAGTTGT
GTAGGGGAGGTAGAGGTAATGAAGCTCTTGAACTGGTTGAGGAATGGAAGAAACGGGATCCGGTGATGGGTGAAAGGAAC
TACAGAACATTGATGGATGAAGTGTATTTTTTAAATAAGGGATGA