Details for Capsella Locus Carubv10013816m

Position : scaf_3 ( 5`- 9138556 .. 9141986 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013816m

Protein [Map View]
MIKTLSLASARIFFSRTSPAISIRCCKLSSSHRREFTTVMASGSDEFVKGHVYPNGVAFITLDRPKALNAMNLEMDLKYK
SLLDEWEFDPRVKCVIVEGSTPRAFCAGGDVKEITTKNQLSDMIEVFTAEYGLICKIAGYKKPYVSLMDGITMGFGIGLS
GHGRYRVITERTVLAMPENGIGLFPDVGFSYIAAQSPGRGSTGAYLGMTGRRISKPSDALFVGLGTHYVPSEKLGSLKEA
ILSADLSQDPHQDIQSTLSNYSSGPESESHLKMFLPQIESAFSASKSVKETIEELKKYQQSTEASVAEWANETLEGLVKG
APFSLHLTHKYFSKVLCAKGKTDNEMATLNGVMKTEYRIALRSALRSDFTEGVRAVLVDKDQNPKWKPASLDEVDETEVD
SLFKPLSPGLEELNV*

DNA
ATGATCAAGACTTTGTCTCTGGCTTCTGCTCGCATCTTCTTCTCCAGAACCTCTCCAGCCATTTCTATTCGCTGCTGTAA
GCTCTCTTCATCGCATCGTCGGGAGTTCACTACTGTGATGGCCAGTGGAAGCGACGAGTTCGTGAAAGGACATGTTTATC
CAAATGGAGTTGCTTTCATCACTCTTGATCGGCCTAAAGCTCTTAACGCCATGAATCTAGAAATGGATTTGAAGTACAAG
AGCTTGCTTGATGAATGGGAATTTGATCCTAGAGTCAAATGTGTTATCGTAGAAGGAAGCACACCTCGGGCCTTTTGTGC
TGGAGGTGATGTGAAGGAGATTACTACCAAAAATCAGTTGTCTGATATGATAGAGGTATTTACAGCTGAGTATGGCCTTA
TATGCAAGATTGCTGGATACAAAAAACCATATGTCTCTTTAATGGATGGCATAACAATGGGCTTTGGTATTGGTCTTTCT
GGACATGGCCGCTACCGGGTGATAACAGAGAGGACGGTCCTCGCAATGCCAGAAAATGGAATAGGCTTGTTTCCAGATGT
TGGTTTTTCATATATAGCAGCTCAAAGCCCTGGTAGAGGATCTACTGGTGCTTACCTTGGTATGACTGGGAGAAGAATTT
CCAAACCTTCAGATGCACTGTTTGTGGGCCTCGGAACACATTATGTACCATCTGAAAAACTAGGTTCACTAAAAGAAGCC
ATTTTGTCAGCCGACCTTTCCCAAGATCCCCATCAAGACATCCAATCAACTTTATCAAATTACAGCAGTGGTCCTGAATC
TGAATCCCACCTCAAAATGTTTTTGCCTCAGATAGAATCAGCTTTTAGTGCAAGTAAGTCTGTTAAGGAAACAATAGAAG
AGCTGAAGAAGTACCAGCAGAGCACTGAAGCTTCAGTTGCAGAATGGGCTAACGAAACACTCGAAGGCCTTGTGAAAGGG
GCACCGTTTTCTCTTCACCTAACGCATAAGTACTTCTCCAAAGTTCTTTGTGCAAAGGGTAAAACTGACAACGAGATGGC
AACGCTTAATGGTGTGATGAAAACTGAGTACCGTATTGCTCTAAGATCTGCTTTGCGCAGTGATTTCACTGAAGGTGTTA
GAGCAGTCTTGGTTGACAAAGACCAGAATCCAAAATGGAAACCAGCAAGCTTAGACGAGGTAGATGAGACAGAAGTGGAT
TCTCTCTTTAAGCCATTAAGTCCTGGACTGGAAGAGCTAAACGTATGA