Details for Capsella Locus Carubv10013815m

Position : scaf_3 ( 5`- 490725 .. 492278 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013815m

Protein [Map View]
MASTKPGHAINLEEQAEGDGVVVDHPIFIPEATSLLVSYSPFDNRDIDCNPYFPFSGPISDSGSGSYSDSEPDPYICPID
FFDQDSSEVDAAEYLESEGLSPGDFNIWGFYDPKEDEDEIVLGTRCVSGSGSDQQPGDSGEQGLRVTGIDSDSDFEDDVF
GYTSEDSGNRANDSDRVEVGTGLPPIWDSVFGEETMLADEEWEEVQNAINWTVRAFGRPEEEEEEGEDELSSLSRDDEEE
HELDWEVLLTVNNVVNYIEQAEGIMINTDDIDPNYYLYLASLDEFDENQSGHYDADAILGQMFDNETGIKGNPPAAKSVT
EDLPVVELTVEELNKGNVVCAICKDEMVVEEKVRRLPCKHFYHGECIMPWLGIRNTCPVCRYELPTDDLEYETHKSSQRS
DTSLARNLPGIYRYS*

DNA
ATGGCGTCGACGAAGCCCGGTCACGCAATCAACCTTGAAGAACAGGCGGAAGGCGACGGTGTAGTCGTAGACCACCCGAT
TTTTATACCGGAGGCCACTAGCTTGCTCGTTTCCTACTCTCCGTTCGACAACAGGGACATCGATTGCAATCCTTATTTCC
CTTTCTCAGGACCAATTTCAGATTCTGGATCAGGTTCTTACTCGGATTCAGAACCCGATCCGTACATATGTCCCATCGAT
TTCTTCGATCAAGATTCGTCCGAGGTTGACGCGGCTGAGTACTTGGAATCGGAAGGGCTGTCCCCCGGTGATTTCAATAT
TTGGGGCTTTTATGACCCCAAGGAAGACGAAGATGAGATAGTTTTGGGAACTAGATGTGTATCTGGATCCGGGTCGGATC
AGCAACCGGGTGATTCAGGTGAGCAAGGGCTTCGAGTGACCGGGATCGATTCGGATTCCGACTTTGAAGATGACGTGTTT
GGTTATACCTCTGAAGATAGCGGGAATAGAGCAAATGATTCGGATCGGGTCGAGGTTGGTACGGGTCTCCCTCCTATATG
GGATAGCGTCTTCGGAGAGGAAACCATGTTGGCTGATGAAGAATGGGAGGAGGTGCAGAACGCAATTAATTGGACGGTTA
GGGCTTTTGGTAGACCTGAAGAAGAAGAAGAAGAAGGTGAAGATGAATTGTCTTCACTCTCAAGGGATGATGAAGAAGAG
CATGAACTGGATTGGGAGGTTTTGTTAACTGTTAACAATGTTGTTAATTATATCGAACAAGCAGAAGGAATCATGATAAA
CACTGATGATATCGATCCGAATTATTACCTTTATCTAGCTAGTTTGGATGAATTTGATGAAAATCAAAGTGGACACTATG
ATGCTGATGCTATTCTTGGGCAAATGTTTGATAACGAGACTGGAATCAAAGGAAATCCTCCAGCAGCCAAAAGTGTAACT
GAGGATCTTCCAGTTGTGGAACTCACAGTGGAGGAATTGAACAAAGGGAACGTGGTTTGTGCGATATGTAAAGATGAAAT
GGTAGTGGAGGAGAAAGTAAGGAGGCTTCCTTGTAAGCATTTCTATCATGGAGAGTGTATTATGCCTTGGTTGGGGATAA
GGAATACTTGCCCTGTTTGTCGGTATGAGCTGCCTACTGATGATCTTGAGTATGAAACGCATAAGAGCTCACAAAGAAGT
GATACCAGTTTGGCAAGGAATCTACCGGGTATCTATAGATATAGTTAA