Details for Capsella Locus Carubv10013813m

Position : scaf_3 ( 5`- 2555833 .. 2557279 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013813m

Protein [Map View]
MASEKSFKKRKITDDVDGAGGELLESLPADIISDILSRLPISSIARLMFVCRSWRSLLTDHGLVPSSSYSPTKPCLLLHC
DSPIRNGLNFLDLSEDEKRIKTKKFTLRFASSMPEFDVVGSCNGLLCLSDSLYNDSLYLYNPFTTNSLELPECSNKYHDQ
ELVFGFGFHETTKEYKVLKIVYFRGGTSSSSNNGVYRGRGRIQYKQSEVQILTLSSRKDQTLSWRSLGKAPYKFMKRSSE
ALVNGRLHFVTRPRRHVPDRKFVSFDLRDEEFIEIPKPECGGLNRTNHRLVNLKGCLCAVVYGNYGKLDIWVMKSYGVKE
SWGKEYSIGTYLPKGLKQNLDRPRWIWKNADNGKVVRVLCVLENGEILLEYKSRVLVAYDPKVGKFKDLLFHGLPNWFHT
VVHVGTLSWFDTPLDL*

DNA
ATGGCCTCAGAGAAGAGTTTCAAGAAGAGAAAGATCACCGATGATGTAGACGGAGCAGGAGGAGAGCTACTAGAATCCCT
TCCCGCAGATATTATATCCGACATACTCTCTCGGCTACCAATCTCCTCCATAGCTCGCCTTATGTTCGTTTGCAGATCTT
GGAGATCCCTTTTGACTGACCACGGTCTTGTCCCTTCTTCTTCTTATTCCCCGACAAAGCCATGTCTTCTCCTTCACTGC
GATTCCCCAATACGCAACGGCCTCAACTTCCTCGACTTATCAGAAGATGAGAAACGCATCAAGACCAAAAAATTCACCTT
AAGATTCGCATCTTCCATGCCGGAGTTTGACGTGGTGGGATCATGTAACGGTTTGCTCTGTTTATCTGATTCTCTCTACA
ACGACTCACTCTACCTCTACAATCCTTTCACTACCAACTCCTTAGAGCTTCCCGAGTGTTCAAACAAGTACCACGACCAA
GAACTCGTGTTCGGTTTCGGATTCCATGAGACGACCAAGGAATACAAAGTGTTGAAGATAGTTTACTTCAGAGGTGGTAC
TAGTAGTAGTAGCAATAACGGTGTTTACAGAGGTCGTGGTAGAATCCAGTACAAGCAGTCCGAGGTTCAGATCTTAACCT
TGTCGTCAAGGAAAGATCAAACTCTGTCTTGGAGAAGCTTAGGCAAAGCTCCTTATAAGTTTATGAAGCGTTCATCGGAG
GCTTTGGTCAACGGGAGGTTACATTTCGTGACAAGGCCTCGCAGGCACGTGCCGGACCGTAAGTTCGTATCATTTGATCT
CCGAGATGAAGAGTTTATAGAGATACCTAAACCGGAATGCGGCGGACTAAACCGGACCAACCATAGGCTAGTTAACCTTA
AAGGGTGTCTTTGCGCGGTCGTTTATGGAAACTACGGAAAATTAGACATATGGGTAATGAAGAGTTACGGGGTAAAGGAA
TCTTGGGGGAAAGAGTATAGCATTGGGACTTACTTGCCCAAGGGGCTAAAGCAGAATCTGGACAGACCCAGGTGGATTTG
GAAGAACGCTGATAATGGTAAAGTGGTTCGGGTTTTATGTGTTTTGGAGAATGGAGAGATTTTGCTGGAGTATAAGAGTA
GGGTTCTTGTTGCATATGATCCTAAAGTGGGTAAATTCAAAGATCTTCTTTTCCATGGTTTGCCTAATTGGTTTCACACT
GTTGTTCATGTTGGAACATTGTCTTGGTTTGATACACCACTTGATTTGTGA