Details for Capsella Locus Carubv10013812m

Position : scaf_3 ( 5`- 6382246 .. 6384786 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013812m

Protein [Map View]
MRGALFRNASLCARRIILSPRITHRSSPNVPFLAPIAAPVSLKFRFFSSESDTSGESTTTASEPSSVDSSVKNDLVVEDV
SNKELKSRIEKYFNEGNEDALPGVIEALLQRRLVDKHAETDDELMEKLESLPFKDDVKDEDFESDFEEAHSTDEELEDLY
NSPEYVAEKMRKDEFFNMDDKKWDDMIREGIQHGCLMDTKECEEILEDMLKWDQLLPDDLKKKVEAKFNELGDMCERGEL
EPEAAYELFKEFEDEMVIQYGNQMEAEGPPKFGETDASDRNTDLDDPPGKGPILRWQSRIVFAPGGDAWHPKNRKVKMSV
TVKELGLSKHQARRLRELVGKRYHSGKDELTITSERFEHREENRKDCLRTLYGLIEEAAKANKIAEDIRTSYVKQRLQAN
PAFMEKLQAKIIRSKE*

DNA
ATGAGAGGAGCTCTCTTCAGAAATGCATCTCTCTGCGCTCGCAGAATCATCCTTTCTCCTCGGATAACTCATCGAAGCTC
CCCCAATGTTCCCTTCCTCGCTCCAATCGCTGCTCCGGTTTCTCTCAAATTCAGATTTTTCTCCTCCGAATCCGACACGT
CCGGTGAGAGCACGACTACTGCTTCCGAGCCTTCTTCGGTAGATTCATCCGTTAAGAATGATCTTGTTGTTGAGGATGTA
AGCAACAAAGAGCTCAAATCCCGTATAGAGAAGTATTTCAATGAGGGTAATGAAGATGCTTTGCCCGGAGTTATTGAAGC
ACTTCTGCAGAGAAGACTTGTAGACAAACACGCAGAGACAGATGATGAATTGATGGAAAAACTCGAGAGTCTGCCTTTCA
AAGATGATGTGAAGGATGAAGATTTTGAATCTGATTTCGAGGAAGCACATTCCACTGACGAAGAACTCGAGGATTTGTAC
AACTCTCCAGAATATGTAGCAGAAAAAATGAGGAAGGATGAATTTTTCAACATGGACGATAAGAAGTGGGATGACATGAT
TAGAGAAGGTATCCAACATGGGTGTCTTATGGATACTAAGGAATGTGAGGAAATTCTTGAGGATATGCTCAAATGGGACC
AGCTTCTTCCTGATGACTTGAAGAAAAAAGTGGAAGCAAAGTTTAATGAGCTTGGAGATATGTGTGAAAGAGGTGAACTT
GAGCCCGAAGCTGCTTATGAGCTTTTCAAGGAATTTGAAGATGAGATGGTAATTCAGTATGGGAATCAAATGGAAGCCGA
GGGTCCTCCCAAATTTGGTGAAACGGATGCATCTGATAGGAACACCGATTTGGATGATCCCCCCGGTAAAGGCCCAATCC
TCAGGTGGCAATCAAGGATAGTTTTTGCTCCAGGAGGCGATGCGTGGCATCCAAAGAACAGGAAAGTTAAAATGTCTGTT
ACAGTGAAAGAGCTCGGGCTCTCAAAGCATCAGGCTCGAAGGCTAAGGGAACTTGTGGGGAAAAGATACCATTCGGGGAA
GGACGAGCTTACAATCACCAGTGAGAGGTTTGAACACCGAGAGGAAAACAGGAAAGACTGCTTGAGAACTCTTTATGGGT
TGATAGAGGAAGCTGCGAAAGCGAACAAGATCGCTGAGGACATAAGAACTTCATATGTAAAACAGAGACTCCAAGCCAAT
CCAGCTTTTATGGAGAAACTACAAGCCAAGATCATAAGGTCTAAAGAATAA