Details for Capsella Locus Carubv10013811m

Position : scaf_3 ( 5`- 6656209 .. 6658974 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013811m

Protein [Map View]
MRFVAPPLSSIDISPSPSPSSGVSEEILSRSSDPPLEFSPPLIAMVVVLAAAFLFVTYSRLISRRFISPLFRRFRRWRCR
RRRLLHLSSASSASTSSSDLRSFSPFPFDSFHYSSYSPYGLDDSVIKTLPLFLYSAAACTGKTTVGKSSTADCRDCAVCL
LEFEEGDYVRTLPLCFHAFHLECIDEWLRSHPNCPLCRTAILGSAGAGVLTPMSPFVPLMAPRIRPSLDDDERNAIIIRG
EITPSRSSWNTISADTAVTTNDHEITVSMEEQSSPAISRFRELKRSYSFECERESESERVTMEPATVSPWRYRRSTWNKR
QSPFGNLISKSRVFSFRYYRSTKSPFFRRRSSAGVFFPISERIPATGSSSRRTKSMTSPMFFRTAPHSSSRLRCGDPEAL
LSPERWRRRDTCRVEM*

DNA
ATGCGATTCGTCGCGCCACCGCTTAGTTCCATCGATATTTCACCGTCTCCTTCACCATCTTCCGGAGTATCGGAGGAGAT
TCTTTCCCGTTCATCGGATCCTCCTTTGGAGTTTAGTCCTCCACTGATCGCTATGGTGGTTGTTTTAGCCGCCGCTTTTC
TTTTCGTCACCTACTCTCGTCTTATCTCCCGCCGTTTTATCTCTCCTCTTTTCCGTCGTTTTCGACGGTGGCGTTGCCGT
CGGCGCCGTCTCCTTCACTTATCTTCAGCTTCCTCTGCTTCCACATCTTCCTCCGATCTCCGATCCTTTTCCCCTTTCCC
TTTCGACTCTTTTCACTACTCTTCTTACTCTCCCTACGGATTAGACGATTCCGTCATCAAAACTCTACCCTTATTCCTCT
ACTCCGCCGCCGCTTGCACCGGGAAGACCACGGTCGGGAAATCTTCCACCGCTGACTGCAGAGATTGCGCTGTTTGTTTG
TTGGAATTCGAAGAAGGTGACTATGTACGAACACTTCCGTTATGTTTCCATGCTTTTCACCTTGAATGCATCGATGAATG
GCTCCGATCTCACCCTAACTGTCCGCTATGCCGGACGGCCATTCTCGGATCCGCCGGCGCCGGGGTTTTAACGCCTATGT
CTCCGTTCGTTCCGTTGATGGCTCCTCGAATTCGCCCGAGCCTCGACGATGATGAGCGTAACGCGATCATCATCCGCGGC
GAAATCACACCGTCGCGGAGCAGTTGGAACACAATCTCTGCTGATACGGCGGTCACGACGAACGATCATGAGATCACAGT
GTCGATGGAAGAGCAATCATCACCGGCGATTTCTCGGTTCCGGGAGCTGAAGAGATCGTACTCGTTCGAATGCGAGAGAG
AATCGGAATCAGAGAGAGTAACGATGGAGCCAGCGACGGTGTCTCCGTGGAGATACAGGAGATCTACGTGGAACAAACGT
CAATCACCGTTCGGAAACCTAATTTCGAAATCGAGAGTGTTCTCGTTCCGTTACTACAGAAGCACGAAATCACCGTTCTT
CCGACGGAGATCATCGGCGGGAGTGTTTTTCCCGATATCGGAACGGATTCCAGCGACGGGAAGCTCATCGCGGCGGACGA
AATCGATGACGAGTCCGATGTTCTTCAGAACAGCACCACACTCATCGAGCCGGTTAAGATGCGGAGATCCAGAGGCACTG
TTATCGCCGGAGAGATGGAGGAGAAGGGACACGTGTAGGGTAGAGATGTAA