Details for Capsella Locus Carubv10013809m

Position : scaf_3 ( 5`- 13511907 .. 13513925 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013809m

Protein [Map View]
MAHSWEQLGDFASVAQLTGVDAVKLIGMIVSAANTARMHKKNCRQFAQHLKLIGNLLEQLRISEMKQYSEILEPLEGLED
ALRRSYILVNSCQEKSYLYLLAMGWNIVYQFRKAQDEIDRYLKIIPLITLVDNVRIRERLEVIDCDQREYTLDEEDWKDQ
DVILKQVSTREAAKSVLKKTLSRSYPNMGFCQALKREEEKLQYELQRSRARYDVDECEVIQRLIDVTQTAASADDTDPEK
VKSSKEDLTSSQKKDDLYETDSDIRTTSRSTSYVSSGHDLLSRKSSQHREEWHTDLLDCCSEPCLSLKTFFFPCCTLAKI
STVATGRQISSAKACNQLMVYSLILSCCCYTCCIRKKLRKTLNIKGGSIDDFLSHLMCCCCALVQELREVKIRGANSHGT
EKDMKEMSPPTPQFMEE*

DNA
ATGGCTCATTCATGGGAACAATTAGGAGATTTTGCGTCAGTAGCTCAGCTTACAGGCGTAGACGCCGTGAAACTGATTGG
AATGATAGTGAGCGCAGCGAATACGGCTCGAATGCACAAGAAGAACTGTCGTCAGTTCGCTCAGCATCTTAAGCTCATTG
GTAATTTGCTGGAGCAGCTTAGGATCTCTGAGATGAAGCAATATTCAGAGATTCTTGAGCCCCTTGAAGGGCTTGAAGAT
GCTCTTAGAAGATCTTACATTTTAGTTAATAGTTGTCAAGAAAAGAGTTATCTTTACTTGTTGGCTATGGGATGGAACAT
TGTTTACCAGTTTCGTAAAGCTCAAGACGAGATTGATCGCTATCTTAAGATCATTCCACTCATCACTTTGGTGGACAACG
TTCGCATTCGGGAGAGGTTAGAAGTTATAGATTGTGATCAGCGTGAGTACACTCTTGATGAAGAGGATTGGAAGGATCAA
GATGTTATTTTGAAACAAGTATCCACTAGAGAAGCTGCTAAATCAGTTTTAAAGAAGACTCTCTCTCGTTCTTACCCGAA
CATGGGGTTCTGCCAAGCGCTCAAGAGAGAGGAGGAGAAACTGCAATACGAGTTGCAACGTTCACGGGCGCGTTATGATG
TTGATGAATGTGAAGTCATACAACGTTTGATTGATGTTACACAAACCGCTGCTTCTGCTGATGATACTGATCCTGAAAAG
GTTAAATCTAGTAAAGAAGACCTTACCTCTAGCCAGAAGAAAGATGATTTGTATGAAACCGATAGTGATATTCGAACAAC
TTCAAGATCAACGTCTTATGTTTCATCGGGACATGATCTTCTTTCAAGAAAATCATCGCAACACCGTGAGGAATGGCACA
CTGACTTGTTGGATTGTTGTTCAGAACCTTGTCTAAGCTTGAAGACATTCTTTTTCCCTTGTTGTACATTGGCAAAGATC
TCTACTGTGGCAACTGGTAGACAAATCTCTTCAGCTAAAGCTTGTAATCAGCTAATGGTATATTCTTTGATACTCTCATG
TTGCTGCTACACTTGCTGCATAAGGAAGAAGCTTCGAAAGACACTGAACATAAAGGGAGGGTCCATTGACGACTTCTTGT
CACATCTAATGTGTTGTTGTTGTGCCCTTGTCCAAGAACTGAGAGAAGTCAAGATCCGTGGCGCTAACTCGCACGGTACA
GAGAAGGATATGAAGGAAATGAGTCCACCAACACCTCAGTTCATGGAAGAATGA