Details for Capsella Locus Carubv10013808m

Position : scaf_3 ( 5`- 8303986 .. 8305963 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013808m

Protein [Map View]
MDPSFRFIKEEFPTGFSDSLSSPSSSSSSSYLYSSSMAEASPYDPTTLSYPQPVEGLHESGPPPFLTKTYDLVEDSRTNH
VVSWSKSNNSFIVWDPQAFSVILLPRFFKHNNFSSFVRQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKNIRRRKTSNNS
NQVQQSNSSEQQALDNCCIEVGRYGLDGEMDSLRRDKQVLMMELVRLRQQQQSTKMYLTTIEEKLKKTESKQQQMMSFLA
RAMQNPDFIQQLVEQKEKRKEIEEAISKKRQRPIDQGKINVVNVGDYDDESGYGNDAAASTSAFLDMNQETYGNMSQFEM
SELDRLAMHIQGLGDHSSTREEVLNVERGNEEEEEEDLQQQGYNQKVDKEIYGEGFWEDLLNEGQNFDFEGDQENVDVLI
EQLGYLGSSSHTNFRRN*

DNA
ATGGACCCTTCATTTAGATTCATTAAAGAGGAGTTTCCTACTGGATTCAGTGATTCTTTATCATCACCATCTTCTTCTTC
TTCTTCCTCTTACTTGTATTCATCTTCCATGGCTGAAGCATCCCCTTATGATCCAACAACATTGAGCTATCCACAACCAG
TAGAAGGTCTCCATGAATCAGGGCCACCTCCTTTCTTGACAAAGACATATGACTTGGTTGAAGATTCAAGAACCAATCAT
GTTGTGTCTTGGAGCAAATCCAATAACAGTTTCATTGTCTGGGATCCACAAGCCTTTTCAGTCATTCTCCTCCCTAGATT
CTTTAAGCACAATAACTTCTCTAGCTTTGTCCGCCAGCTCAACACTTATGGTTTCAGAAAGGTGAATCCGGATCGATGGG
AGTTTGCAAATGAAGGGTTTCTTAGAGGGCAAAAGCATCTTCTCAAGAACATAAGGAGAAGGAAGACAAGCAACAATAGT
AATCAGGTGCAACAATCAAACAGCTCTGAACAACAAGCTCTAGACAATTGTTGCATTGAAGTCGGTAGGTATGGTCTAGA
TGGAGAGATGGATAGCCTAAGGCGAGACAAACAAGTTCTGATGATGGAGCTAGTGAGACTGAGACAGCAACAACAAAGCA
CCAAAATGTATCTCACAACAATTGAAGAGAAGCTCAAGAAGACTGAATCAAAACAACAACAAATGATGAGTTTCCTCGCC
CGTGCAATGCAAAATCCGGATTTTATTCAGCAGCTTGTCGAGCAGAAGGAGAAGAGGAAGGAGATCGAAGAGGCCATCAG
CAAGAAGAGACAAAGACCAATCGATCAAGGGAAAATAAATGTGGTTAATGTTGGAGACTATGATGATGAAAGTGGTTATG
GGAACGATGCTGCAGCCTCAACCTCGGCGTTTCTTGATATGAATCAAGAAACATATGGAAACATGTCTCAATTCGAGATG
TCGGAGTTGGACAGACTTGCTATGCACATTCAAGGACTTGGAGATCATTCCAGTACTAGAGAAGAAGTCTTGAATGTGGA
AAGGGGAAATGAAGAGGAGGAAGAGGAAGATCTACAACAACAAGGGTATAACCAAAAGGTGGACAAGGAGATTTATGGTG
AAGGTTTTTGGGAAGATTTGTTAAATGAAGGTCAAAATTTTGATTTTGAAGGGGATCAAGAAAATGTTGATGTGTTAATT
GAGCAACTTGGTTATTTGGGTTCTAGTTCACACACTAATTTTAGAAGAAACTGA