Details for Capsella Locus Carubv10013806m

Position : scaf_3 ( 5`- 2136932 .. 2139478 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013806m

Protein [Map View]
MEAAQGSASTLAGFKGRRRRSALPRRPRHIKESLHSFTFLPPSSTALSNEPNPNVRNTNSLCGSVTENPLKLKLKLGGVT
RTIQTNSEAGAYTDTLDDGQKPLKNKVKGNGLERRHGQKTLFLKEIHQSRGYTSETVNGASMSEKSKRGLKKRVLDPEPD
SDDDDGDEEIRYLEKLKSKRVRDPQEGKESEGSKRLHSNGHGMEDREQFSSGKLAVSERKKPRMGMVDSLPAGASGQIPT
TRTRALQSGKDPYSVIGSRPLEFPDGLPCPSSRRQKQKLSDVEQQSKKAEAAQRRRMQSEKAAQEAEAEAIRKILGQDSG
RKKKEEKIKKQQEERAQERAARSSTLASNTIRLVIGPSGTTMTFSEDIGLPDIFKPITYGYPPPREKCVGPNCEKEYKYR
DSKTKLPLCSLGCYKAI*

DNA
ATGGAAGCCGCTCAAGGTTCTGCTTCTACTTTAGCTGGTTTCAAAGGTAGGAGAAGGAGAAGTGCTCTGCCTCGTCGACC
ACGCCATATAAAAGAGAGCTTGCATAGTTTCACCTTTTTGCCACCCTCAAGCACAGCTCTTAGCAATGAACCTAACCCAA
ATGTTAGGAACACCAATAGTCTCTGTGGGTCTGTGACTGAGAACCCACTGAAACTGAAGCTTAAGCTTGGTGGTGTTACA
CGTACGATCCAAACCAACTCTGAGGCGGGTGCTTACACCGATACTTTGGATGACGGACAAAAGCCATTAAAAAATAAGGT
AAAAGGCAATGGACTAGAGCGCAGACATGGTCAGAAAACACTGTTTTTGAAGGAGATCCATCAATCTAGAGGATATACCT
CTGAGACTGTGAATGGTGCATCCATGTCCGAGAAGAGCAAACGTGGTCTTAAGAAACGCGTATTGGATCCAGAACCAGAC
AGTGATGATGATGATGGAGATGAGGAAATCAGATACCTCGAGAAGTTAAAGTCTAAAAGGGTCAGGGACCCTCAGGAAGG
TAAAGAGAGTGAAGGAAGCAAAAGGTTACACAGCAATGGTCATGGCATGGAAGACAGAGAACAATTCTCATCTGGAAAAC
TTGCTGTGTCTGAAAGGAAAAAACCGAGGATGGGAATGGTTGATTCGCTCCCGGCAGGAGCAAGTGGACAAATTCCTACA
ACACGTACCCGTGCTCTCCAATCAGGAAAAGATCCATATTCTGTCATCGGATCTAGACCTCTTGAATTCCCTGACGGCTT
ACCTTGCCCCTCATCTAGAAGACAAAAACAGAAGCTTTCTGATGTAGAACAACAATCCAAGAAGGCCGAAGCTGCACAGA
GACGGCGAATGCAGTCTGAGAAGGCTGCCCAAGAAGCCGAGGCTGAAGCTATCAGGAAAATTCTCGGACAAGATTCTGGA
AGGAAGAAAAAAGAGGAGAAGATAAAAAAACAGCAGGAAGAACGAGCTCAGGAAAGAGCTGCAAGATCAAGCACACTCGC
ATCAAACACTATCAGATTGGTGATCGGTCCAAGCGGAACAACAATGACATTTTCTGAAGACATTGGTCTTCCAGATATCT
TCAAGCCGATCACGTACGGTTATCCTCCACCACGGGAGAAATGTGTGGGACCAAATTGCGAGAAAGAGTACAAGTACAGG
GATTCAAAGACGAAGCTACCATTATGCAGTCTCGGATGTTACAAGGCCATTTAA