Details for Capsella Locus Carubv10013804m

Position : scaf_3 ( 5`- 425971 .. 428704 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013804m

Protein [Map View]
MTTIVPTSEEDPFLAVVRFTSQLAWADAGPEAAEPEITRLCKEAEESIVAGKSLELATLMVTSAELVSSKISEKDLECTY
TIICSLVKKVNSPEELLEIVKAISSKVAQQPSDKASLRLKILFNLYNLLDHPYARFQVYMKALTLAVDGKVTEYIVSSFK
KIDNFLKEWNIDIKDQRELFLAIANVLKENKSLVKESLEFLTKYLATFSKEDAQVLDEAKEEAVRAVIEFVKASSIFQCD
LLDLPAVAQLEKDAKYAPVYQLLKIFLTQRLNAYIEFQKANSDFLQSYELVDEDCVTKMRLLSLVDLASDESGKIPYASI
KDTLEVHEEEVELWVVKAITAKLIDCKMDQMNQVVIVSRCSEREFGTKQWQSLRTKLANWRDNISNIITTIESNKVTEEG
SQASSSSAAAIQGLTVR*

DNA
ATGACGACGATTGTTCCCACTTCCGAAGAAGACCCGTTCCTCGCTGTTGTCCGCTTCACTTCCCAGCTCGCCTGGGCCGA
TGCTGGTCCCGAGGCTGCTGAGCCAGAAATTACCAGGCTTTGTAAGGAGGCTGAGGAGTCGATAGTAGCAGGAAAATCGC
TTGAGTTAGCTACGTTAATGGTTACCTCAGCTGAATTGGTATCTTCCAAGATATCTGAGAAAGATCTTGAGTGTACCTAC
ACCATAATTTGCAGCCTTGTCAAGAAGGTGAATAGCCCTGAGGAACTCCTTGAAATTGTGAAAGCTATATCTTCCAAGGT
TGCTCAACAACCCAGTGACAAAGCTTCACTTCGTTTGAAGATCCTCTTCAATCTCTACAACCTTCTGGACCATCCGTATG
CTCGTTTTCAAGTGTACATGAAAGCTCTAACACTGGCTGTTGATGGCAAGGTTACTGAGTACATCGTTTCTTCTTTTAAG
AAGATTGATAACTTTTTGAAAGAGTGGAATATTGACATTAAAGATCAGAGGGAACTCTTTCTTGCCATTGCTAACGTGCT
TAAAGAAAACAAAAGCCTGGTGAAAGAATCCCTTGAGTTCTTGACAAAGTATCTAGCAACTTTCTCCAAAGAAGATGCTC
AGGTCCTGGATGAAGCTAAGGAGGAGGCTGTGCGTGCAGTTATCGAATTTGTCAAAGCTTCCAGTATTTTCCAGTGTGAT
TTATTGGACTTGCCAGCCGTTGCTCAATTGGAAAAGGATGCTAAATATGCACCGGTTTACCAGCTTCTGAAGATCTTTCT
TACTCAGAGACTAAATGCCTACATAGAATTCCAAAAAGCGAATTCGGATTTTCTGCAAAGCTATGAACTTGTCGATGAAG
ATTGCGTTACGAAGATGAGATTGTTGTCACTAGTCGACTTAGCTTCTGATGAATCTGGCAAAATACCTTATGCTTCAATC
AAAGACACGCTAGAGGTACACGAAGAGGAGGTCGAGTTATGGGTTGTGAAGGCAATAACTGCGAAATTGATTGATTGTAA
AATGGATCAGATGAACCAAGTTGTAATTGTCAGCCGCTGTTCCGAACGTGAATTTGGGACAAAACAATGGCAATCGCTTC
GAACAAAGCTTGCTAATTGGCGGGACAACATTTCAAACATCATAACTACAATTGAATCGAATAAGGTAACAGAGGAAGGT
TCTCAGGCATCATCATCATCTGCTGCAGCAATTCAAGGGTTGACTGTTCGTTGA