Details for Capsella Locus Carubv10013803m

Position : scaf_3 ( 5`- 3875492 .. 3878576 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013803m

Protein [Map View]
DWTQHKHKSNKLRRANESSSVKSCFVWLVVASMELSISQSPRVRFSSLAPRILAASHNHHRPSMHLAGRFISHSKDVHFT
SLSSSRMRSKFVSTNYRKISIRACSQVGAAGSDPMLDRISRFQNACWRFLRPHTIRGTALGSTALVTRALIENTHLIKWS
LVLKALSGLLALICGNGYIVGINQIYDIGIDKVNKPYLPIAAGDLSVQSAWLLVIFFAIAGLLVVGFNFGPFITSLYSLG
LFLGTIYSVPPLRMKRFPIAAFLIIATVRGFLLNFGVYHATRAALGLSFQWSAPVAFITSFVTLFALVIAITKDLPDVEG
DRKFQISTLATKLGVRNIAFLGSGLLLVNYISAISLALYMPQIFRGSLMIPAHVILASGLIFQTWVLEKANYTKEAISGY
YRFIWNLFYAEYLLFPFL*

DNA
GATTGGACACAACACAAACACAAGTCAAACAAACTTCGGCGTGCAAATGAAAGTAGCAGCGTAAAGAGTTGTTTTGTGTG
GCTAGTGGTGGCATCAATGGAGCTCTCGATCTCGCAATCACCGCGTGTCCGGTTCTCGTCTCTGGCACCTCGTATCTTAG
CAGCTTCTCATAATCACCATCGCCCTTCGATGCATTTAGCTGGGAGGTTTATAAGCCACTCTAAAGATGTTCACTTCACG
AGCTTATCATCTTCGAGAATGCGGTCCAAATTTGTTTCAACAAATTATAGAAAAATCTCGATCCGGGCATGTTCTCAGGT
TGGTGCTGCTGGTTCTGATCCAATGCTGGATAGAATTTCCCGGTTCCAAAATGCTTGCTGGAGATTTCTTAGGCCCCATA
CAATCCGCGGAACAGCTTTAGGATCCACTGCCTTGGTGACAAGAGCTTTGATAGAGAACACTCATCTGATCAAGTGGAGT
CTTGTACTCAAGGCACTTTCAGGTCTTCTTGCTCTTATATGTGGGAATGGTTATATAGTTGGCATCAATCAGATCTACGA
CATTGGAATCGACAAAGTGAACAAACCGTACTTGCCAATAGCAGCAGGAGATCTATCAGTGCAGTCTGCTTGGTTGTTGG
TGATATTTTTTGCGATAGCAGGGCTTCTAGTCGTCGGATTTAACTTTGGTCCTTTCATTACATCTCTATACTCTCTTGGC
CTTTTTCTGGGAACCATCTATTCTGTTCCACCATTGAGAATGAAAAGATTCCCAATTGCAGCATTTCTTATTATCGCCAC
GGTGCGAGGATTCCTTTTAAATTTTGGTGTTTACCATGCTACAAGAGCTGCTCTTGGACTTTCGTTTCAGTGGAGTGCAC
CTGTGGCTTTCATCACATCTTTTGTGACACTGTTTGCGCTGGTCATTGCTATTACAAAAGATCTTCCTGATGTCGAAGGA
GATCGAAAGTTCCAAATATCAACCCTGGCAACAAAACTTGGAGTGAGAAACATTGCATTCCTCGGTTCTGGACTTCTGCT
AGTGAACTATATTTCCGCCATATCACTAGCTCTCTACATGCCTCAGATTTTCAGAGGTAGCTTGATGATTCCTGCACACG
TGATCTTGGCTTCAGGCTTAATTTTCCAGACATGGGTACTAGAAAAAGCTAACTACACTAAGGAAGCTATCTCAGGATAT
TATCGGTTTATATGGAATCTCTTCTACGCAGAGTATCTGTTATTCCCCTTCCTCTAG