Details for Capsella Locus Carubv10013801m

Position : scaf_3 ( 5`- 5603328 .. 5606265 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013801m

Protein [Map View]
MTDKVDSGDIATEKNPKELVLTKLEPSLVVPESPVEELPPNSREPSETKDKRDEEGISTWMKHKGCRCKQSKCLKLYCDC
FASGLLCTDDCDCADCHNNSENFDARDTALKRVLARNPNAFNGKSFSSLIDKQCKAEPDTKLGLLSRGCKCKRTRCLKKY
CECFQANVLCSDNCKCISCKNVGEASQPSGFALGLNNRKLQEGFDNPEKKIVCENIVNDIGIISPSGHSVGFNSHNTEGG
MNYAPAFSGHNSPQVYQRRRHRELPQPDSCPAPLFLLPENSIQNALGSPMSSSPSPKLPYRKKPPLGYTSTLVPDVGDIC
SLLVAAYVSATATAEDQNRICINPDDKVDHKSTELLSESESGNVEEEIQSCGRLIELIDAQYNGEEVYETDLYIEQERAV
LATFRDCLQKFIISRLDS*

DNA
ATGACTGATAAGGTAGATTCCGGCGATATCGCGACAGAGAAGAACCCTAAGGAGCTCGTTTTAACGAAATTGGAGCCATC
TCTCGTCGTCCCGGAGTCGCCAGTAGAAGAACTTCCTCCGAATTCTCGAGAGCCTTCAGAAACAAAGGATAAGAGAGATG
AGGAAGGGATTAGTACTTGGATGAAGCACAAAGGATGTCGATGCAAGCAGTCCAAATGTTTAAAGTTGTACTGCGATTGC
TTTGCATCAGGACTATTATGTACCGACGACTGTGACTGTGCTGATTGTCATAACAACTCTGAAAACTTTGATGCAAGAGA
TACAGCTCTGAAGAGGGTACTAGCTCGCAACCCAAATGCCTTTAATGGAAAGTCTTTCAGCAGCCTCATTGACAAGCAGT
GTAAGGCTGAACCTGATACTAAACTTGGACTGCTTTCGAGAGGCTGCAAATGCAAAAGAACCAGGTGTTTGAAGAAATAC
TGCGAATGTTTTCAGGCTAATGTTCTATGCTCAGACAACTGTAAGTGTATCAGCTGCAAAAATGTCGGTGAAGCGTCCCA
GCCTTCTGGTTTTGCCTTGGGACTAAACAACAGGAAGCTTCAGGAAGGATTTGATAATCCAGAGAAGAAGATTGTATGTG
AGAACATTGTCAATGATATAGGAATCATTTCTCCTAGTGGACACAGTGTCGGCTTTAACAGCCACAACACTGAGGGAGGT
ATGAATTATGCACCTGCGTTTTCTGGTCACAATTCCCCACAGGTATACCAGAGAAGAAGACACCGAGAGCTACCTCAGCC
GGATTCTTGTCCAGCTCCGTTGTTTTTGCTACCTGAAAATTCCATTCAAAATGCTCTGGGTTCCCCTATGTCTAGCTCTC
CCTCTCCTAAGCTTCCTTACAGGAAAAAGCCCCCGTTGGGATATACTTCCACACTTGTTCCGGACGTAGGAGATATATGC
TCACTTCTCGTAGCAGCATATGTATCTGCTACAGCCACTGCAGAAGACCAGAACAGGATTTGTATAAATCCTGATGATAA
GGTAGACCACAAGAGCACTGAGCTATTGAGTGAGTCTGAGAGCGGTAATGTAGAAGAAGAAATACAATCCTGTGGAAGAT
TGATCGAACTGATAGATGCTCAATACAATGGAGAGGAGGTCTATGAAACAGATCTATACATAGAGCAGGAAAGGGCAGTG
CTAGCAACGTTTAGAGACTGTCTCCAGAAGTTCATCATATCGAGACTGGATTCATAA