Details for Capsella Locus Carubv10013800m

Position : scaf_3 ( 5`- 1226531 .. 1230319 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013800m

Protein [Map View]
MADNLFSGLPPPSSSQQQEPPISPKPDESKNETSSPAPTLVLKSALKRSKPEQSASNVSAPPVLKSALKRSKPAESTPEP
EPEPEPEVAAPKKRLQFKTSTDASEEQVIEAMQKITSHIKNPSKFSKASKLAIRLIQAGSVKPETSNYFIAILEAAMSSK
TPCTDRLVRADFHALFSAAQDVAECLDKSQKNLLTIWTYRAVVANDLFTDDSFMFSKTATRIKEAISDLPVSIEEEDVEE
AAILEEAAVKDNGDGQTTQDVASAEDNENVESDPFGLDALIPSSGKKNCKTKIRKTNEDTEAEESKRFLRSKREALITCL
EIAARRYKVPWCQTVIDILVKHAFENVSRFTSQQRQAVEKLWASVREQHLRRKQGKSVTGKLDVTAFEALQDKYANEKMS
IRSSVGASGERRAQQWLG*

DNA
ATGGCGGACAATCTATTCTCAGGGCTGCCACCTCCTTCTTCATCTCAGCAGCAAGAGCCACCAATTTCTCCCAAACCAGA
CGAGTCGAAGAATGAAACTTCCTCTCCAGCTCCGACTCTGGTTCTCAAGAGTGCCCTGAAGCGATCGAAGCCAGAACAAT
CTGCATCCAATGTTTCAGCTCCTCCTGTTCTCAAGAGCGCACTAAAGCGATCAAAACCAGCTGAATCTACACCGGAACCA
GAACCTGAACCAGAACCGGAAGTTGCAGCCCCTAAAAAGCGTCTACAGTTTAAGACATCAACCGATGCATCAGAGGAACA
AGTAATAGAAGCGATGCAGAAGATAACATCTCATATCAAGAACCCTTCCAAGTTCTCCAAAGCCTCAAAGCTCGCGATAC
GGCTGATCCAAGCTGGAAGTGTGAAGCCAGAAACAAGCAACTACTTCATTGCCATACTTGAAGCTGCCATGTCGTCAAAA
ACTCCTTGTACAGATCGCTTGGTTCGAGCAGACTTTCATGCATTGTTCTCAGCTGCACAAGATGTAGCCGAGTGCCTTGA
CAAAAGCCAGAAGAATCTGTTGACGATATGGACATACAGAGCAGTTGTTGCTAATGACCTTTTCACTGATGACAGCTTTA
TGTTTTCCAAGACTGCTACTCGAATAAAGGAGGCTATATCTGATCTTCCGGTTTCAATTGAGGAGGAGGATGTGGAAGAA
GCAGCTATTCTTGAAGAAGCGGCGGTGAAGGATAACGGAGATGGCCAGACAACGCAGGACGTGGCTTCAGCTGAAGATAA
TGAAAATGTCGAGTCTGACCCCTTTGGGCTAGATGCCTTGATTCCCAGTTCCGGAAAGAAAAATTGTAAAACAAAGATAA
GGAAAACAAATGAAGATACAGAAGCCGAGGAGAGTAAGAGGTTTCTCAGGTCAAAAAGAGAAGCTTTGATTACATGCTTG
GAGATTGCTGCACGCCGTTACAAAGTTCCATGGTGCCAAACTGTTATAGACATATTGGTGAAACATGCTTTTGAGAACGT
GTCAAGGTTTACATCACAGCAGAGACAAGCAGTTGAGAAACTCTGGGCTTCTGTTCGTGAACAACATCTCCGTAGGAAGC
AAGGCAAATCTGTCACAGGAAAACTCGACGTGACAGCTTTTGAAGCGCTTCAGGATAAATACGCCAACGAGAAAATGAGC
ATCCGAAGCTCAGTTGGAGCTAGCGGTGAACGCCGTGCACAGCAATGGCTCGGTTGA