Details for Capsella Locus Carubv10013795m

Position : scaf_3 ( 5`- 8912098 .. 8915679 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013795m

Protein [Map View]
MEEDTHDGSLDLQQIRSRVKELESIHRNCKYEPGESCTSDSENLVQDFVLQFETKVNEIVEDYSDVDILDVEDSDAYLEY
LRKELHSVEAESAKVSEEIERLSRSHAEDSSRLERDLEGLLLSLDSMSSQDVNKSKESPPSCSSMEVCEVNDDDKFKMFE
LENQMEEKRMILKSLEDLDSLRKRFDAAEQVEDALTGLKVLEFDGNFIRLQLRTYIPELDGLPAQHKFEHTTKPSELIHE
LLIYLKDKTTEITKLEMFPNDVYIGDIIEAADSFRQVRLHSAVLDTRSSVQWVVAKVQDRIITTTLRKYIVTSSKTMRHT
FKYYDKDETIVAHIAGGIDAFLKVSDGWPLLNSPLKLASLKNSDNQSKGISLSLICKVEELANSLDLQTRQNLSGFIDAI
EKILVHQTREELQSNDSSQK*

DNA
ATGGAAGAAGATACCCACGACGGATCTCTCGATCTGCAACAGATTCGCAGCCGCGTGAAAGAGCTCGAGTCCATTCACCG
GAACTGCAAATACGAACCTGGAGAATCATGTACTTCCGATTCCGAGAATCTGGTCCAAGATTTTGTTCTTCAGTTTGAGA
CGAAGGTGAATGAGATTGTTGAAGATTATAGCGATGTTGATATATTGGATGTTGAAGATTCAGATGCATACTTGGAGTAC
TTGAGAAAGGAGCTTCATTCTGTGGAGGCTGAAAGTGCCAAAGTTTCTGAAGAAATTGAACGTCTTTCTAGGTCTCATGC
TGAAGATTCTAGTAGGCTGGAAAGGGATCTTGAAGGTCTTTTACTGTCTCTGGATTCTATGTCGTCACAGGATGTGAACA
AGTCAAAAGAGAGTCCACCATCTTGCAGCTCAATGGAAGTATGCGAAGTGAATGATGATGACAAGTTTAAGATGTTTGAA
CTCGAAAATCAGATGGAGGAGAAAAGGATGATTCTTAAGTCACTGGAAGATCTGGATTCTTTACGTAAAAGGTTTGATGC
GGCAGAACAAGTTGAGGACGCATTGACAGGCTTGAAGGTGCTCGAATTTGATGGAAACTTTATTAGGCTCCAACTGCGAA
CATATATTCCCGAACTAGACGGCTTGCCTGCACAGCACAAATTTGAACACACTACTAAGCCATCTGAATTGATCCACGAA
TTGCTAATATATCTGAAGGATAAAACTACAGAGATAACAAAATTGGAGATGTTTCCAAATGATGTATATATAGGAGACAT
CATCGAGGCTGCTGATTCTTTCAGGCAGGTAAGGTTACACTCTGCAGTGCTAGACACAAGATCGTCAGTCCAGTGGGTTG
TCGCCAAAGTGCAAGATAGAATCATTACAACCACTTTGAGAAAATATATTGTGACGAGTTCGAAAACAATGAGGCACACG
TTCAAATACTACGACAAAGATGAAACAATTGTGGCTCATATAGCTGGAGGTATTGATGCATTTTTAAAGGTCTCTGATGG
TTGGCCACTGCTGAATTCCCCATTGAAGCTTGCATCTCTCAAGAACTCGGACAATCAGTCAAAGGGAATATCTCTGAGCC
TTATCTGCAAAGTTGAGGAACTAGCGAATTCCTTGGATTTACAGACCCGGCAAAACTTATCAGGCTTCATTGATGCTATT
GAGAAGATACTAGTGCATCAAACCCGTGAAGAACTTCAGTCCAATGATTCCTCCCAAAAGTGA