Details for Capsella Locus Carubv10013792m

Position : scaf_3 ( 5`- 7621037 .. 7623570 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013792m

Protein [Map View]
MGFDLRQVVAGILTITMFVMLGQMLHRDYYDSLQEKVQGDAQDIEFEGSKVAVKDGLVGTVEGSKGPWMEDNTDLNPCWP
TLLSDEAVSSSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGATLVLPDIRGSKPGDEKSFEDIYDADKLIKSLENVVKV
VKQLPEEVSLRNIAIVKVPTRVTEDYIKEHIDSVFKSKGNIRVASYFPSVNLRKSSQDGETDPVACLAMFGSLELQPEVN
AVAEAMVERLRTHSRKSGGRFIAVDLRIDVLEKKNCHTTGVTGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLN
ILKDIFPKTFTKEAIMPASKRSKYLETESSEYENVIDFYISSRSDVFVPAISGLFYANTVGKRIALGKPQVLVPAETSGL
ATDFISPYISKKNHLAYSCFC*

DNA
ATGGGTTTTGATCTGAGGCAAGTAGTTGCTGGTATTCTCACCATTACCATGTTTGTGATGCTTGGGCAGATGCTTCATAG
AGATTACTATGATTCTCTTCAGGAAAAAGTTCAGGGAGATGCACAAGATATTGAATTTGAAGGATCTAAAGTCGCTGTGA
AAGATGGTCTTGTCGGAACCGTTGAAGGCAGTAAAGGACCTTGGATGGAGGATAACACTGATCTTAATCCTTGTTGGCCA
ACATTACTATCCGATGAAGCGGTATCATCATCATCAAAAGGGTATGTCACATTCTCACTAACGAATGGTCCTGAGTACCA
TATTTCTCAGATCACTGATGCTGTAATGGTGGCAAAGCATCTAGGAGCAACTCTAGTACTTCCTGATATTAGAGGAAGCA
AACCTGGTGATGAAAAGAGTTTTGAAGATATCTATGATGCGGATAAACTAATTAAAAGCTTGGAGAATGTCGTTAAAGTT
GTGAAACAATTGCCTGAAGAAGTTTCTCTAAGGAACATCGCCATTGTGAAGGTCCCTACCAGAGTTACAGAAGATTACAT
TAAGGAGCACATTGATTCCGTCTTCAAATCGAAAGGAAACATTCGAGTTGCATCATACTTCCCTTCTGTGAACTTGAGGA
AATCCTCACAAGATGGCGAAACTGATCCTGTCGCGTGTTTAGCAATGTTTGGGTCATTGGAGCTGCAACCTGAAGTCAAT
GCAGTGGCTGAAGCAATGGTTGAGCGGTTGAGGACTCATAGCCGGAAATCAGGTGGCCGTTTCATAGCGGTAGACCTTAG
AATCGACGTACTTGAGAAGAAAAATTGCCATACAACTGGTGTTACAGGGTCCAAGACATGTTACAACGCGCAAGAGATTG
CTTTATTCTTGAGGAAGCTTGGATTTGCCAGCGACACAACTATCTATCTAACTCAGCCAAGATGGGACAGTAGCCTCAAT
ATCCTTAAGGATATCTTCCCAAAAACGTTCACAAAGGAGGCAATAATGCCGGCGAGTAAGAGATCAAAGTACCTTGAAAC
AGAGAGTTCAGAGTACGAAAATGTTATCGACTTCTACATAAGCTCAAGAAGCGATGTCTTTGTTCCAGCCATATCCGGTC
TGTTTTATGCAAACACAGTTGGAAAAAGGATAGCTTTAGGTAAGCCTCAAGTGCTAGTTCCTGCAGAGACATCTGGCCTT
GCTACAGATTTCATCTCTCCGTACATCTCAAAGAAGAACCACTTGGCTTATTCATGTTTTTGCTGA