Details for Capsella Locus Carubv10013787m

Position : scaf_3 ( 5`- 8073567 .. 8078763 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013787m

Protein [Map View]
MGASGRWIKALVGFTKSNKSKSSKKDANGKVASKSRFGRKNSIDFDFEKFQDGFEDSNTRSVMDTGVSTSTSLQSYGGPA
YEEQSREHQAATRIQTAYRGFLARRALRALKGLVRLQALVRGHAVRKQAAVTLRCMQALVRVQARVRARRVRLALELESE
TGQQTLQQQLADEARVREIEEGWCDSIGSVEQIQAKLLKRQEAAAKRERAMAYALTHQWQAGTRQLSAHSGFQPDKNNWG
WNWLERWMAVRPWENRFLDSNLRDDAKLGENSMDQSENVHKTQMKSASKIPNTSNLVSGVSSQMTGPCLSDGNSSSPGIS
SSIPVVSRAKTKSAKDDLAVEVSSRPGAGPRSHSNPKERSREPIRSSKERLSLPNNGKYLGSQPAKANRAGKLMPTSHKV
VEEKSAQNQGRRNSDPIKQRLA*

DNA
ATGGGTGCTTCAGGGAGATGGATTAAAGCATTGGTTGGTTTTACGAAATCTAATAAGTCTAAGTCCTCGAAGAAGGATGC
AAATGGGAAGGTGGCGTCCAAGAGTAGGTTTGGGAGAAAGAATTCAATTGATTTCGATTTTGAGAAGTTTCAAGATGGAT
TTGAAGATTCCAATACGCGTAGTGTGATGGATACCGGAGTCTCTACATCAACTTCACTACAATCATACGGGGGACCAGCT
TATGAGGAACAAAGTAGGGAACATCAAGCTGCAACGCGTATCCAAACAGCTTATCGGGGATTTCTGGCTAGAAGGGCTTT
ACGAGCGTTGAAGGGATTGGTTAGACTTCAAGCACTTGTTAGAGGACATGCTGTGAGAAAACAAGCTGCTGTAACTCTTC
GATGCATGCAAGCGTTGGTAAGAGTTCAGGCTCGTGTACGCGCAAGACGTGTTCGTCTGGCCTTGGAATTGGAAAGTGAA
ACGGGTCAGCAGACACTTCAGCAACAGCTAGCTGATGAAGCCCGAGTTCGAGAAATAGAGGAAGGTTGGTGCGATAGCAT
TGGATCTGTTGAACAAATCCAAGCGAAGCTGCTAAAGAGGCAGGAAGCTGCAGCTAAGCGTGAGAGGGCTATGGCATATG
CTTTGACTCATCAGTGGCAGGCAGGAACTCGGCAGTTATCTGCTCACAGTGGCTTTCAACCTGACAAAAACAACTGGGGA
TGGAACTGGTTGGAAAGATGGATGGCTGTTCGTCCATGGGAGAACCGGTTTCTTGACAGTAACCTCAGGGATGATGCGAA
ATTAGGTGAAAACAGTATGGATCAGTCTGAGAATGTGCATAAAACACAGATGAAAAGTGCAAGCAAGATTCCAAACACTT
CAAATCTTGTATCCGGTGTTTCAAGTCAGATGACTGGCCCATGTCTGTCGGATGGTAATTCTTCTTCTCCTGGAATATCT
TCAAGCATTCCAGTGGTATCCAGGGCTAAGACAAAGTCTGCTAAAGACGATCTTGCTGTAGAAGTTAGCTCAAGGCCTGG
AGCTGGTCCTAGATCGCACAGCAATCCAAAAGAAAGATCAAGGGAGCCAATTAGATCTTCAAAGGAACGATTATCTCTGC
CAAATAATGGAAAATATTTAGGATCTCAGCCAGCTAAAGCCAACCGAGCTGGAAAACTCATGCCAACCTCTCATAAAGTA
GTTGAGGAAAAATCTGCCCAAAACCAGGGAAGACGTAACTCCGACCCAATAAAACAGAGGCTTGCATAG