Details for Capsella Locus Carubv10013786m

Position : scaf_3 ( 5`- 1804228 .. 1807341 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013786m

Protein [Map View]
MADLLPIYLIILAFLCTVGAIALALFHIYKHLLNYTEPIYQRYIVRIVFMVPVYALMSFLALVLPKSSIYFNSIREVYEA
WVIYNFLSLCLAWVGGPGSVVISLTGRSMKPSWHLMTCCFPPLPLDGRFIRRCKQGCLQFVILKPILVAVTLVLYAKGKY
KDGNFSPDQSYLYLTIIYTISYTVALYALVLFYVACKDLLQPFNPVPKFVIIKSVVFLTYWQGVLVFLFAKSGFIRDEEE
AALFQNFIICVEMLIAAAAHFYAFPYKQYAEANVGGARSFSRSLAHAVMLNDFYHDTVHQFAPTYHDYVLYNHSDGGEEG
TRKYRARTFVPTGQEMDAVRKNKHMFGNKIDGVSVSSQSAETSTPKTSGVSCDGARPETMKSSLLVDASDSASTMYDMSL
IDIDISSYPSKVPSANSSGGPK*

DNA
ATGGCGGATTTGCTACCCATTTACCTCATTATTCTGGCATTCCTATGCACTGTCGGAGCCATTGCTTTGGCCTTATTCCA
TATCTACAAGCACCTTTTGAATTATACTGAACCCATTTATCAGAGATATATTGTGCGCATCGTCTTCATGGTCCCGGTCT
ATGCCTTGATGTCATTTTTGGCTCTTGTGTTACCCAAGAGCTCCATTTATTTTAACTCTATCCGAGAAGTTTACGAAGCA
TGGGTAATCTATAATTTTCTATCGCTGTGTTTGGCATGGGTTGGAGGCCCAGGTTCAGTAGTTATAAGCTTAACTGGCCG
CTCTATGAAGCCATCGTGGCATCTAATGACATGTTGCTTCCCACCACTACCATTAGACGGGCGTTTTATTCGACGGTGCA
AGCAAGGTTGTCTGCAATTTGTAATTCTAAAGCCAATCCTAGTTGCTGTCACACTTGTGCTTTATGCAAAAGGAAAATAC
AAGGATGGGAATTTTAGCCCTGATCAATCCTATCTCTATCTAACCATCATCTATACAATATCATACACAGTAGCTTTGTA
CGCCCTGGTCCTATTTTATGTGGCATGCAAAGATCTGCTTCAGCCATTCAATCCAGTCCCGAAGTTTGTGATTATAAAGT
CTGTTGTCTTTCTAACTTATTGGCAGGGTGTTCTAGTTTTCCTTTTTGCCAAATCTGGATTCATAAGGGATGAAGAAGAA
GCAGCTCTCTTCCAAAATTTTATAATATGTGTGGAGATGCTTATTGCTGCAGCTGCACATTTCTATGCATTTCCATACAA
GCAATATGCAGAGGCAAATGTTGGAGGAGCTCGAAGTTTCTCAAGAAGTCTGGCACATGCTGTTATGCTAAATGATTTCT
ACCATGATACTGTTCACCAGTTTGCCCCTACATATCACGATTATGTGCTCTATAATCATAGTGATGGTGGTGAGGAAGGG
ACAAGGAAGTACCGAGCACGAACATTTGTGCCAACTGGTCAGGAAATGGATGCTGTTAGAAAGAACAAACACATGTTTGG
AAACAAGATAGATGGTGTTTCCGTCTCTAGTCAATCTGCAGAAACAAGCACACCCAAAACCTCTGGTGTAAGTTGTGATG
GTGCACGCCCTGAGACCATGAAATCTTCTTTGCTTGTGGATGCCTCAGATTCGGCTTCCACAATGTATGACATGTCGCTC
ATTGACATCGATATATCGAGCTACCCTAGCAAGGTACCTTCTGCAAATTCAAGTGGGGGGCCTAAATAG