Details for Capsella Locus Carubv10013785m

Position : scaf_3 ( 5`- 3037043 .. 3039984 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013785m

Protein [Map View]
MDLTGRFHNLFISGLVSGESINVNLFQVQRSKKSPLCLFPLCVLLRLEAITMAAFLARRLIGNRSSQILGTSSSSSGAFI
SVARAFSSSTTPIKATLFPGDGIGPEIAESVKQVFTAADVAIDWDEHFVGTEVDPRTNSFLTWESLQSVLKHKVGLKGPM
ATPIGKGHRSLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEYSGLEHQVVKGVVESIKIITRKASMRV
AEYAFLYAKTHGRKKVSAIHKANIMQKTDGLFLQCCDEVARKYPDIEYEKVVIDNCCMMLVKNPALFDVLVMPNLYGDII
SDLCAGLVGGLGLTPSCNIGEDGIALAEAVHGSAPDIAGKNLANPTALLLSGVMMLRHLKLNKQAEQIHSAIINTIAEGK
YRTADLGGTSTTTDFTKAICDHL*

DNA
ATGGATCTAACCGGCCGGTTTCACAATTTATTCATATCCGGTTTGGTATCTGGAGAAAGTATAAATGTTAATCTTTTTCA
GGTCCAACGCAGCAAAAAGTCTCCTCTCTGTCTCTTTCCTCTTTGCGTCCTTCTGAGGCTTGAAGCGATTACCATGGCAG
CATTTCTCGCGAGACGGCTTATCGGTAACCGTTCGAGCCAGATTCTCGGTACTTCGAGCTCTAGCTCCGGTGCGTTCATT
TCTGTTGCTAGGGCTTTCTCCTCCTCCACCACCCCGATCAAAGCAACTCTCTTTCCTGGTGATGGGATCGGTCCCGAAAT
CGCTGAATCTGTCAAACAGGTGTTCACTGCTGCTGATGTGGCCATTGATTGGGACGAACACTTTGTTGGTACTGAAGTAG
ATCCTAGAACCAATAGTTTCTTGACATGGGAAAGTCTTCAATCTGTGCTTAAGCACAAGGTCGGCTTGAAAGGACCAATG
GCTACGCCAATTGGAAAGGGTCACCGTTCTTTGAACCTTACTCTTAGGAAAGAGCTTAATTTGTATGCCAATGTTAGGCC
TTGCTACAGTCTTCCTGGGTACAAAACTCGTTATGATGACGTTGATCTCATTACCATTCGTGAAAACACTGAAGGAGAGT
ACAGTGGCCTCGAACACCAGGTCGTCAAGGGCGTGGTGGAAAGTATTAAAATTATTACCCGTAAGGCGAGTATGAGAGTT
GCCGAGTATGCCTTTCTATATGCCAAGACTCATGGAAGGAAGAAAGTTTCTGCAATTCACAAAGCTAACATCATGCAGAA
AACTGATGGCCTTTTCCTGCAGTGTTGTGATGAGGTTGCTAGGAAGTACCCTGACATAGAGTACGAGAAGGTTGTTATTG
ACAATTGTTGTATGATGCTTGTGAAAAACCCAGCACTTTTTGATGTTTTGGTGATGCCAAATCTCTATGGAGATATTATC
AGCGATTTGTGTGCTGGACTTGTTGGGGGACTAGGATTGACTCCTAGTTGTAATATCGGAGAGGATGGCATCGCCCTTGC
TGAAGCTGTTCACGGCTCTGCACCTGATATTGCTGGAAAGAACCTGGCGAACCCGACAGCTTTGCTTCTGAGTGGAGTGA
TGATGTTGCGGCACCTGAAACTAAACAAACAAGCAGAGCAGATCCACAGCGCCATCATCAACACAATAGCTGAAGGAAAG
TACAGAACGGCTGATCTTGGAGGTACCTCAACGACAACAGATTTCACAAAAGCAATCTGTGATCATCTCTAA