Details for Capsella Locus Carubv10013783m

Position : scaf_3 ( 5`- 9560607 .. 9562141 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013783m

Protein [Map View]
MREGDKKQNRALDFNQLEVLSLLGRGAKGVVFLVKDEEARLLALKVILKEAIKKKKKKDIENQDEYKRVSFEQGVLSSFD
HPLFPSLHGVLSTDKVIGYAIDYCPGRDLTSLRKMQSENMFSDEIIRFYAAELVLALEYLHNQGIVYRDLKPENVMIQEN
GHLMLIDFDLSTNLAPRTPQPSPSPSKPSPETRRRRKKRLFRFSSFCNSGISPEEESDSVCSSSSTLVVSDSSVEKSNSF
VGTEEYVSPEVITGDGHDFAVDWWSLGVVLYEMLYGTTPFRGSNRKETFYRILSKPPSLTGETTSLRDLIRRLLEKDPNR
RINVEEIKGHDFFKGVEWEEVILVSRPPYIPPPDNDGGDKGKDVNTKLDVENIVQEIFVAREEREKQSDDANHMKAKGEK
NRKWVKGLNNNNHDLETDNNFLVF*

DNA
ATGCGAGAGGGAGACAAGAAACAGAACCGGGCTCTAGACTTTAACCAGCTCGAGGTTTTGTCATTACTAGGTCGTGGAGC
TAAAGGGGTTGTGTTCTTGGTTAAAGACGAAGAAGCAAGATTGCTTGCTTTGAAAGTTATACTCAAGGAAGCCATCAAGA
AGAAGAAGAAGAAGGACATAGAGAATCAAGATGAGTACAAACGTGTAAGTTTCGAGCAAGGAGTCTTAAGCAGTTTCGAT
CATCCTCTCTTTCCTTCTCTCCACGGCGTTTTATCTACCGATAAAGTCATCGGTTACGCCATCGATTACTGTCCCGGTCG
AGATCTCACTTCTTTAAGGAAAATGCAATCGGAAAACATGTTCTCCGACGAGATTATTAGGTTTTACGCGGCGGAGCTGG
TGCTAGCTCTTGAGTATTTACATAACCAAGGAATCGTATACAGAGATTTGAAACCGGAGAATGTGATGATCCAAGAAAAT
GGGCATTTAATGCTAATCGATTTCGATCTTTCCACAAATCTCGCTCCAAGAACGCCGCAACCGTCACCGTCGCCGTCTAA
ACCATCGCCGGAGACGAGGAGGAGGAGAAAGAAACGTCTCTTTCGCTTCTCTAGCTTTTGTAACTCAGGGATCTCGCCGG
AGGAAGAATCTGATTCGGTTTGTTCATCATCATCTACATTGGTCGTATCAGATTCTTCAGTAGAGAAGTCTAATTCTTTC
GTCGGAACAGAGGAGTACGTATCACCGGAAGTTATCACCGGAGACGGTCACGATTTCGCCGTTGACTGGTGGTCGTTAGG
TGTAGTTCTATACGAGATGTTATACGGAACGACGCCGTTTAGAGGATCGAACCGGAAAGAGACGTTTTACCGGATTTTAT
CTAAACCGCCGAGTCTAACCGGTGAAACGACGTCGTTGCGTGATTTGATTAGAAGATTGTTGGAGAAAGATCCTAACCGT
AGGATCAACGTTGAGGAAATCAAGGGTCACGATTTTTTCAAAGGTGTAGAGTGGGAGGAAGTGATATTGGTTTCTAGACC
GCCGTATATTCCGCCGCCGGATAATGACGGTGGTGATAAGGGCAAAGATGTAAATACGAAACTTGACGTGGAGAATATAG
TCCAAGAGATTTTTGTTGCAAGAGAAGAACGTGAGAAACAGAGTGATGATGCTAATCATATGAAAGCTAAAGGTGAAAAA
AATAGGAAATGGGTTAAGGGGTTAAATAATAATAATCATGATTTGGAAACTGATAACAATTTTTTGGTATTTTAA