Details for Capsella Locus Carubv10013782m

Position : scaf_3 ( 5`- 3409406 .. 3413787 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013782m

Protein [Map View]
MSWPTDSELISIKEAVSQMTGRDKGEVRVVVAPYRICPLGAHIDHQGGTVSAMTINKGILLGFVPSGDTKVQLRSAQFEG
EVCFRVDEIQHPIGHTSKNDASTPSPSKEKSVWGTYARGAVYALQTSKKNLKQGIVGYLSGSNGLDSSGLSSSAAVGVAY
LLALENANELTVSPTENIEYDRLIENGYLGLRNGILDQSAILLSSYGCLTYMDCKTMNHKLVQAPELEKPFRILLAFSGL
RQALTTNPGYNLRVSECQEAAKVLLTACGNSELEPTLCNVEHAVYEAHKHELKPVLARRAEHYFSENMRVIKGREAWASG
NLEEFGKLISASGLSSIENYECGAEPLIQLYKILLKAPGVYGARFSGAGFRGCCVAFVDAEKAEAAAAYVKDEYEKAQPE
FAKNLNGGKPVLICEAGDAARVLF*

DNA
ATGTCTTGGCCTACGGATTCTGAGTTGATTTCTATAAAAGAGGCCGTGTCACAGATGACTGGAAGAGATAAAGGAGAAGT
TCGAGTGGTGGTCGCACCGTATCGTATATGTCCTTTAGGAGCTCACATAGATCACCAGGGAGGAACTGTATCAGCTATGA
CGATTAATAAAGGGATCCTTCTTGGTTTTGTTCCATCTGGCGATACTAAGGTCCAATTGCGTTCTGCACAATTTGAAGGA
GAAGTATGTTTCAGAGTAGATGAAATCCAGCACCCAATAGGCCACACAAGCAAGAATGATGCAAGTACCCCATCACCATC
AAAGGAAAAAAGCGTCTGGGGAACTTATGCCAGAGGAGCGGTTTATGCGTTACAGACCAGCAAAAAGAATCTCAAACAGG
GCATTGTTGGTTACCTCAGTGGCTCAAATGGACTAGATAGTTCTGGCCTTAGCTCATCAGCTGCTGTTGGTGTGGCGTAC
CTGCTAGCTTTAGAGAATGCAAACGAATTGACTGTATCCCCAACAGAAAATATCGAATATGACAGACTTATTGAGAATGG
GTATCTGGGTCTGCGGAATGGAATTTTGGATCAATCAGCTATTTTGCTTTCCAGTTATGGGTGTCTAACATACATGGACT
GTAAGACTATGAACCACAAGCTTGTACAGGCTCCTGAACTGGAGAAACCGTTCAGGATATTGTTAGCATTCTCAGGCTTG
AGGCAGGCATTGACCACCAACCCAGGATATAATCTGCGAGTTTCTGAGTGTCAAGAGGCTGCAAAAGTTCTTTTGACTGC
ATGTGGGAACAGTGAGCTAGAACCTACCTTGTGCAATGTTGAACATGCGGTGTACGAAGCTCACAAGCATGAGCTAAAAC
CGGTTTTAGCTAGAAGAGCTGAGCATTATTTCTCGGAAAACATGCGGGTTATCAAAGGACGAGAAGCCTGGGCTTCAGGT
AATCTTGAAGAATTCGGAAAGCTAATTTCAGCATCCGGCTTGAGTTCTATTGAGAATTACGAATGCGGTGCGGAGCCACT
GATTCAGCTATACAAGATTCTCCTGAAGGCTCCTGGTGTATATGGTGCTCGGTTCAGTGGTGCAGGTTTCAGGGGATGTT
GTGTGGCATTTGTAGATGCAGAAAAAGCTGAGGCAGCTGCTGCATATGTGAAGGATGAATATGAAAAGGCCCAACCCGAG
TTTGCTAAGAATCTGAATGGAGGAAAACCTGTTCTCATCTGTGAAGCAGGTGACGCTGCTCGTGTTCTTTTTTGA