Details for Capsella Locus Carubv10013781m

Position : scaf_3 ( 5`- 7685036 .. 7688469 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013781m

Protein [Map View]
SVKWQKKVFESIEIDTSQPPYVFKAQLYDLSGVPPERQKIMVKGGLLKDDADWTTLGLKNGQKLMMMGTADEIVKAPEKG
PVFLEDLPEEEQAANLGYSAGLVNLGNTCYMNSTMQCLKSVPELKSELSDCNRELFSELDKSVKAVAPMPFWMMLQKKYP
QFAQLHNGNHMQQDAEECWTQMLYTLSQSLKPPSPSEDPDAIYDIYCPVFSFFPCTEWKKWLHCQESSEESSETESVFSL
KCHISHEVNHLHEGLKHGLKGELEKTSPALGRTAVYIKDSLIDSLPRYLTIQFVRFFWKRESNQKAKILRKVDYPLELDI
YDLCSEDLKKKLEAPRQKLRDIEGQKLGLQASAKSSLKGDDVKMTDAEGSSELANHPPVTNREIYSLRTGSQHLSCLACN
ALYSLYVDSNFRYMQCAKLSCVSI*

DNA
AGTGTGAAGTGGCAAAAGAAAGTGTTTGAGAGTATCGAGATTGATACTAGCCAGCCTCCTTATGTTTTCAAGGCTCAGTT
GTATGATTTGAGTGGTGTACCTCCAGAGCGGCAAAAGATCATGGTCAAAGGTGGACTTTTGAAGGATGATGCAGATTGGA
CCACTTTGGGACTGAAAAATGGTCAAAAATTGATGATGATGGGAACTGCAGATGAAATAGTGAAGGCTCCAGAGAAAGGT
CCAGTTTTTTTGGAGGATCTTCCTGAAGAAGAGCAGGCTGCTAATCTGGGTTACAGTGCTGGCCTAGTCAATCTTGGAAA
CACCTGCTACATGAACTCAACGATGCAATGTTTAAAATCTGTCCCAGAGTTGAAATCTGAATTATCCGATTGCAACCGTG
AGTTATTTAGTGAGCTTGATAAAAGTGTCAAGGCTGTTGCACCTATGCCGTTCTGGATGATGTTACAGAAAAAATATCCT
CAGTTTGCTCAGTTGCATAACGGGAATCACATGCAACAGGATGCTGAAGAATGTTGGACACAAATGCTGTACACTCTTTC
CCAATCCCTAAAACCACCATCGCCTAGCGAAGATCCTGATGCTATATATGACATTTACTGTCCAGTGTTTTCTTTCTTTC
CTTGCACAGAATGGAAGAAATGGTTGCATTGCCAAGAAAGTAGCGAAGAAAGCTCAGAGACAGAATCTGTCTTTTCTCTT
AAATGTCACATATCACATGAGGTGAATCACCTGCATGAAGGATTAAAACATGGACTGAAAGGAGAACTTGAAAAAACATC
TCCTGCTCTGGGTCGTACAGCGGTTTACATAAAGGATTCTCTTATAGATTCATTGCCAAGGTACTTGACTATTCAGTTTG
TGAGATTCTTCTGGAAACGGGAGAGTAATCAGAAAGCAAAAATTCTCCGGAAAGTGGACTATCCGTTGGAGTTGGACATA
TATGATCTTTGTTCTGAGGATCTTAAGAAGAAACTGGAAGCTCCTCGCCAGAAACTGAGAGATATTGAAGGTCAAAAGCT
TGGTCTGCAAGCCAGTGCAAAAAGTAGCTTAAAGGGTGATGATGTGAAAATGACTGATGCTGAGGGATCATCGGAATTGG
CGAATCATCCACCAGTGACCAACAGGGAGATATATTCTCTAAGAACCGGTTCTCAACATCTTTCTTGTCTAGCTTGCAAT
GCGTTGTATAGTCTATATGTTGATTCAAATTTTCGTTATATGCAATGTGCGAAGTTATCTTGTGTGAGTATTTGA