Details for Capsella Locus Carubv10013779m

Position : scaf_3 ( 5`- 8806406 .. 8809096 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013779m

Protein [Map View]
SHFLIQNPITIKIFHLQSPRRFLLCRATMAVFSGATTLGSVSFSSHLFDQQSCFLSCPLRLLPSSSSSTYSPSHRSSLLC
IVKSLSSSATADTDRNSDQSSSSSVLSASNSLLRDTSDDAAAAAGPSDWKIAKAYCKSGDTFKGQVDGFNGGGLLIRFHS
LVGFLPYPQLSPSRSCKEPQKSIHEIAKTLVGSKLPVKVVQADEENRKLILSEKLALWPKYSQNVNVGDVFTGRVGSVED
YGAFIHLRFDDGLYHLTGLVHVSEVSWDYVQDVRDVLRDGDEVRVIVTNIDKEKSRITLSIKQLEDDPLLETLDKVILKD
SSTGSPSLSSDNGDKIEPLPGLETILEELLKEEGIEAVKINRQGFEKRVVSQDLQLWLSNTPPSDGKFVLLARAGRQVQE
IHLTTSLEQGGIKKALQHVLERVP*

DNA
TCTCACTTTCTTATCCAAAATCCCATTACCATTAAAATCTTCCACCTTCAGTCTCCGCGGCGTTTTTTGCTCTGCCGCGC
AACAATGGCGGTGTTCAGTGGCGCTACCACATTGGGTTCTGTTTCATTCTCCTCTCATCTCTTCGACCAACAATCCTGTT
TCCTCTCTTGCCCACTTAGACTCCTCCCTTCATCATCCTCTTCTACTTATTCTCCATCACATAGAAGCTCTCTGCTCTGT
ATCGTCAAATCCTTATCAAGCTCCGCCACAGCAGATACCGATAGAAACTCCGATCAATCATCCTCTTCCTCAGTTCTCTC
CGCTTCCAATTCTCTTCTCCGTGATACCTCCGATGATGCTGCTGCTGCTGCAGGACCAAGCGATTGGAAAATAGCAAAGG
CTTATTGTAAAAGTGGTGATACATTTAAAGGTCAAGTTGATGGCTTTAATGGTGGAGGCTTGCTTATACGTTTTCATTCT
CTTGTGGGGTTTCTTCCTTATCCACAATTAAGTCCTTCACGTTCTTGTAAAGAGCCTCAGAAGAGTATTCATGAGATAGC
TAAGACTTTGGTTGGTTCTAAACTTCCTGTAAAGGTTGTTCAAGCTGATGAGGAAAATAGAAAGTTGATTTTATCTGAGA
AGTTAGCATTATGGCCAAAGTATTCACAAAACGTTAATGTGGGGGATGTGTTTACTGGGAGAGTAGGTTCTGTTGAGGAC
TATGGTGCCTTTATCCATTTGCGTTTCGATGATGGTCTTTATCATTTAACCGGACTAGTGCATGTCTCTGAAGTCTCGTG
GGATTACGTTCAAGATGTTAGGGATGTACTACGCGATGGTGATGAGGTTCGGGTAATAGTCACGAATATTGATAAAGAGA
AATCAAGGATTACATTATCCATCAAACAGCTGGAAGATGATCCTCTTCTAGAAACATTGGACAAAGTGATTTTGAAGGAC
AGCTCTACTGGATCTCCATCACTAAGCTCGGACAATGGGGATAAAATTGAACCTCTTCCAGGGCTAGAAACAATACTTGA
AGAGCTATTGAAGGAAGAAGGAATAGAAGCTGTGAAAATCAACCGGCAAGGATTTGAGAAAAGAGTAGTTTCACAAGACC
TACAACTTTGGCTCTCAAATACACCGCCTTCTGACGGGAAATTTGTTCTTCTTGCTCGTGCTGGAAGACAGGTGCAAGAG
ATACACTTGACGACGTCTCTAGAACAAGGAGGAATCAAGAAAGCCCTTCAGCATGTACTAGAACGCGTCCCATAA