Details for Capsella Locus Carubv10013778m

Position : scaf_3 ( 5`- 8397963 .. 8399482 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013778m

Protein [Map View]
MESLPQPQNQSSPAKFLLGKYELGRRLGSGSFAKVHLARSIDSDELVAIKIIEKKKTIESGMEPRIIREIDAMRRLRHHP
NILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALSFSHRDGVAHRDVKPQNLLLDEQGNLK
VSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRKGYDGAKADAWSCGVILFVLLVGNVPFDDSNIAAMYRKIHRRDYK
FPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTSWFKKSLETSEFHRNVFDSEPEMKSSVSSITAFDLISLSSGLDLSGL
FEVKKKKERRFTAKVTAVEVEEKVKEIGEKLGYVVKKKMKKEGEAKVVGLGRGRTAIVVEAVEVAVDVVVVEVKVVEGEE
DDSRWCDLVTELEDIVLSWHNDIM*

DNA
ATGGAATCACTTCCTCAGCCACAGAACCAGTCATCTCCGGCGAAGTTTCTCCTCGGCAAATACGAACTCGGTCGCCGACT
CGGAAGCGGAAGCTTCGCGAAAGTCCATTTAGCTCGTTCAATCGATTCCGACGAGCTCGTCGCCATTAAAATCATCGAGA
AGAAGAAAACAATCGAATCCGGCATGGAGCCGCGAATCATCAGAGAGATCGATGCGATGCGTCGTCTCCGTCATCATCCA
AACATACTCAAGATCCATGAAGTTATGGCTACCAAATCTAAGATCTACCTCGTAATGGAACTCGCTTCAGGTGGTGAGCT
ATTCTCAAAAGTCCTCCGCCGTGGTCGTCTCCCCGAATCGACGGCGCGTCGTTACTTCCAACAACTCGCCTCCGCGCTCA
GCTTCTCTCACCGAGACGGTGTCGCTCACCGCGACGTGAAACCGCAGAATCTACTCTTGGATGAGCAAGGTAACCTCAAG
GTCTCTGACTTCGGTTTATCTGCTTTACCGGAACATCTCCAGAACGGATTGCTTCACACGGCGTGTGGTACTCCGGCTTA
CACAGCTCCGGAGGTTATCTCACGGAAGGGATACGACGGAGCAAAAGCTGATGCGTGGTCTTGTGGTGTGATTTTGTTCG
TTCTATTAGTCGGTAATGTTCCTTTCGATGATTCGAATATCGCAGCGATGTATCGGAAGATTCATCGGAGAGATTATAAA
TTCCCGAGCTGGATCTCGAAACAAGCTAAATCGATTATATATCAGATGTTAGATCCGAATCCAGTAACGAGGATGAGTAT
TGAAACAGTTATGAAGACGAGTTGGTTCAAGAAGTCTCTAGAAACTTCTGAGTTTCACCGTAACGTGTTTGATTCAGAGC
CGGAGATGAAATCGAGTGTTAGTTCGATTACTGCTTTTGATCTGATCTCGTTATCGTCGGGGTTAGATCTTTCGGGATTG
TTTGAGGTTAAGAAGAAGAAGGAGAGGAGATTCACGGCGAAGGTTACAGCTGTTGAAGTGGAGGAGAAGGTGAAGGAGAT
TGGGGAGAAGTTAGGGTATGTAGTGAAGAAGAAGATGAAGAAAGAAGGAGAAGCGAAGGTGGTTGGATTAGGGAGAGGAA
GGACAGCGATTGTGGTGGAAGCTGTGGAGGTAGCTGTTGATGTTGTGGTGGTTGAAGTGAAAGTTGTTGAAGGTGAAGAA
GATGATTCACGGTGGTGTGATTTGGTTACAGAGCTTGAAGATATAGTTCTTTCATGGCACAATGACATTATGTAA