Details for Capsella Locus Carubv10013777m

Position : scaf_3 ( 5`- 6059331 .. 6061119 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013777m

Protein [Map View]
LPSPLYSTHTSLAQLFSHSPFKVSLLNRIGKMESFLFTSESVNEGHPDKLCDQISDAILDACLEQDPESKVACETCTKTN
MVMVFGEITTKANVDYEQIVRKTCREIGFVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEVGAGDQGHMFGY
ATDETPELMPLTHVLATKLGAKLTEVRKNGTCPWLRPDGKTQVTIEYLNENGAMVPVRVHTVLISTQHDETVTNDEIAAD
LKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQA
AKSIVASGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILEIVKESFDFRPGMISINLDLKRGGNGRFLKTAAYG
HFGRDDADFTWEVVKPLKSNKVQA*

DNA
CTTCCTTCACCTTTGTACTCTACCCACACTTCTTTAGCTCAACTCTTCTCTCATTCACCTTTCAAGGTTTCTTTGTTGAA
TCGGATCGGAAAAATGGAATCTTTTTTGTTCACCTCTGAATCCGTCAACGAGGGACATCCCGACAAGCTTTGTGATCAGA
TCTCCGACGCTATCCTCGATGCTTGCCTTGAACAAGACCCTGAGAGCAAAGTTGCTTGCGAGACCTGTACCAAGACTAAC
ATGGTCATGGTTTTTGGAGAAATCACCACCAAGGCTAACGTTGACTACGAGCAGATTGTCCGTAAAACGTGCCGTGAGAT
CGGTTTCGTATCTGCCGATGTTGGTCTAGATGCTGACAACTGCAAGGTTCTTGTCAACATCGAGCAACAGAGTCCTGATA
TTGCACAAGGTGTTCATGGTCATCTCACCAAGAAACCAGAGGAGGTTGGAGCTGGTGACCAAGGTCATATGTTTGGGTAC
GCTACTGATGAGACTCCTGAGCTCATGCCTCTTACTCACGTTCTCGCCACTAAGCTCGGAGCTAAGCTCACTGAAGTTCG
CAAGAATGGAACTTGCCCCTGGTTGAGGCCGGACGGTAAGACTCAAGTCACTATTGAGTACTTGAACGAAAACGGAGCTA
TGGTCCCTGTACGTGTCCACACTGTTCTCATCTCAACACAGCACGATGAGACTGTGACTAACGATGAGATCGCAGCTGAT
CTCAAGGAGCACGTGATCAAGCCTGTGATCCCAGAGAAGTACCTTGATGAGAAGACCATCTTCCATCTCAACCCATCTGG
TCGTTTTGTGATTGGAGGTCCTCATGGAGATGCAGGGCTTACCGGCCGTAAGATCATCATCGACACCTACGGTGGATGGG
GTGCACACGGAGGTGGTGCTTTCTCCGGAAAGGACCCAACCAAGGTTGACAGGAGTGGAGCTTACATCGTTAGGCAAGCA
GCTAAGAGCATTGTTGCTAGTGGACTAGCAAGGCGGTGCATTGTGCAAGTCTCATACGCCATTGGTGTCCCTGAGCCATT
GTCTGTGTTCGTGGACAGTTATGGAACAGGGAAGATACCAGACAAGGAGATTCTTGAGATTGTTAAGGAGAGTTTTGATT
TCAGGCCAGGTATGATCTCGATTAACTTGGATTTGAAGAGAGGAGGTAATGGTAGGTTCTTGAAGACTGCTGCTTATGGC
CACTTTGGAAGGGATGATGCTGATTTCACCTGGGAGGTAGTGAAGCCACTCAAGTCTAACAAGGTCCAAGCTTGA