Details for Capsella Locus Carubv10013776m

Position : scaf_3 ( 5`- 6011918 .. 6013885 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013776m

Protein [Map View]
MRQSKASVTQTWLLYTQLCLWKDLIIRCVRKFIIKAKSMILSQNMVADSAEISVIDVKSHLSVGKDPSSFQIAEIRIHDS
VCIEIPGSEETPLLGSVKSCSAAATIIEEPATEYVPNISSGSYADKGDYREYMEDEHICIDDLSVHLGSSFYRFPVPIAF
YGVFDGHGGSEASQYIKENAMRLFFEDAVFRESPSVVDSLFLKELEKSHRKAYRLADLAMEDERIVSTSCGTTALTALVI
GRHLLVANAGDCRAVLCRKGKAVDMSFDHKSTFEPERRRVEDLGGYFEGEYLYGDLAVTRALGDWSVKRFSPLGGSFSPL
ISDPDIQQMILTEEDEFLIMGCDGVWDVMTSQYAVTFVRQGFRRHGDPRRCAMELGREALRLDSSDNVTVVVICFTSSPA
PQRRKIRFCVSDEARARLQTMLEG*

DNA
ATGCGTCAAAGCAAAGCTTCAGTGACCCAAACATGGCTGCTTTACACACAGCTTTGTCTTTGGAAAGATCTCATAATCAG
ATGTGTCCGCAAGTTCATAATAAAAGCAAAATCGATGATTTTGAGTCAAAACATGGTCGCCGATTCTGCTGAGATCAGTG
TCATTGACGTCAAGTCTCATCTCTCCGTCGGGAAAGATCCCAGTAGCTTTCAGATTGCCGAGATTCGAATTCATGATTCC
GTTTGTATAGAGATTCCTGGCTCTGAAGAAACGCCTCTATTAGGATCGGTCAAGAGCTGTTCTGCAGCTGCAACGATTAT
TGAAGAGCCTGCTACTGAGTATGTACCAAATATAAGCTCTGGGAGTTATGCAGATAAGGGTGACTACCGGGAATACATGG
AAGATGAACACATATGCATAGACGACCTTTCAGTTCATCTTGGATCTTCCTTCTACAGATTTCCTGTACCTATCGCTTTC
TACGGTGTGTTTGATGGCCATGGTGGATCTGAGGCATCACAGTATATTAAAGAGAATGCAATGAGATTGTTCTTTGAAGA
TGCTGTTTTCCGAGAATCTCCCTCGGTTGTGGACTCTCTTTTCTTGAAAGAACTGGAAAAGTCTCACCGGAAAGCTTATA
GGCTTGCTGATCTTGCCATGGAAGATGAAAGAATAGTTAGCACTTCGTGCGGAACAACCGCCTTGACCGCTCTTGTAATT
GGAAGACATTTATTGGTTGCTAACGCTGGTGATTGCCGTGCAGTGCTCTGCAGAAAAGGAAAGGCGGTTGATATGTCATT
TGATCACAAATCTACATTTGAGCCAGAACGGAGACGGGTAGAGGATTTAGGAGGGTACTTTGAAGGCGAGTATCTCTACG
GTGACCTTGCTGTTACAAGAGCTCTTGGAGACTGGTCAGTAAAGAGGTTTTCACCTCTCGGTGGATCTTTCTCACCTCTC
ATCTCGGACCCGGACATTCAACAGATGATTCTAACAGAGGAAGACGAATTCTTGATTATGGGATGTGATGGTGTTTGGGA
TGTGATGACTAGCCAGTATGCTGTTACTTTTGTAAGGCAAGGATTCAGGAGACACGGTGACCCGAGAAGATGCGCTATGG
AACTTGGAAGGGAAGCGTTGAGGCTTGATTCATCAGATAACGTTACAGTGGTTGTCATCTGTTTCACATCATCACCAGCT
CCACAGAGGAGAAAAATACGGTTCTGTGTTTCTGATGAAGCCCGAGCCCGGTTACAGACAATGCTAGAAGGCTAA