Details for Capsella Locus Carubv10013775m

Position : scaf_3 ( 5`- 4026097 .. 4028098 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013775m

Protein [Map View]
MATFALPFCEIPEDLQLRILSFLTPAEISSFACTSKRFASLCQEDGKIWHAMCDRRWGKKTKIQKWGNGKVAYRLLYKTL
KGFENLIGFWRLCGRANPAASSPPLVFFDWGPSFVLGSRVLASGDDTYQVKKTPFLLMGISSEGRSQNFLDLGGGDNLRS
GDDFKEFEASSSANLVPVDVNFMGNGHIMVEENRYVTNNPREEQKSSGDESDDLVSSPDFSEMYTQLANKTSPGGDRRRQ
RRKEKERQASRTKWEPEHFIKVADCSPTPTKPLQGLWKGFCEGRNMELYLVKYDDVGGIICRKVEDLSLSRQTPPVFWTP
NHVVIRSPFSAEEELLLNSRIHISPLAQVHENVVSGMLYMNSSYDLVLPGEAGNGGGFLRGEGRVWLYENGTFSFGFLRD
QFIIDLKHVALEDGCLADELVACM*

DNA
ATGGCTACATTTGCACTTCCATTTTGCGAAATTCCCGAGGATCTCCAGCTCCGAATCTTGTCTTTCCTCACACCGGCAGA
GATCTCCAGCTTCGCCTGCACATCGAAACGCTTCGCCTCGCTGTGTCAGGAAGACGGCAAAATCTGGCACGCTATGTGCG
ATCGCAGATGGGGGAAGAAGACGAAGATCCAGAAATGGGGAAACGGTAAAGTCGCGTATAGACTCCTTTACAAGACTCTC
AAGGGATTTGAGAATCTAATTGGATTCTGGCGTCTCTGCGGCAGAGCAAATCCCGCCGCTTCGTCGCCGCCTCTTGTTTT
CTTCGATTGGGGTCCGTCGTTTGTATTGGGATCTAGAGTTTTAGCCTCCGGAGATGATACTTATCAGGTTAAGAAGACGC
CATTTCTCTTGATGGGGATTTCGTCGGAGGGACGATCTCAGAACTTCTTGGATCTCGGTGGCGGTGATAATCTTAGATCT
GGGGATGATTTTAAAGAATTCGAAGCTTCTTCGAGTGCAAATCTCGTCCCGGTGGATGTGAATTTCATGGGGAATGGTCA
TATCATGGTGGAGGAGAATCGATATGTTACTAACAATCCTAGAGAAGAGCAGAAGAGCTCAGGGGACGAGAGTGATGATT
TGGTCTCATCGCCCGATTTTTCGGAAATGTACACTCAATTAGCGAATAAGACGAGCCCAGGCGGTGACAGAAGGAGACAG
AGGAGGAAGGAGAAGGAGAGGCAAGCGTCGAGGACTAAGTGGGAACCAGAACACTTTATCAAAGTTGCTGATTGCTCACC
CACGCCTACTAAGCCATTACAAGGCTTATGGAAGGGATTTTGTGAGGGAAGGAACATGGAGTTATATCTGGTCAAATACG
ATGACGTTGGAGGCATTATATGCAGAAAAGTAGAGGATTTGTCCTTATCACGGCAAACTCCTCCTGTGTTCTGGACACCC
AATCACGTGGTCATCAGATCTCCCTTTTCAGCTGAAGAAGAGCTGCTGTTGAATAGTCGAATTCATATCAGTCCTCTCGC
CCAAGTTCATGAAAATGTTGTCTCTGGCATGTTGTACATGAACTCTAGTTACGATCTGGTGTTGCCAGGAGAAGCAGGCA
ATGGTGGTGGTTTTCTCAGAGGTGAAGGGCGGGTCTGGTTGTATGAAAATGGAACTTTCAGTTTTGGGTTTCTTCGGGAT
CAATTCATCATTGATCTGAAACATGTTGCTCTAGAAGATGGTTGCCTGGCGGACGAGTTGGTAGCTTGTATGTGA