Details for Capsella Locus Carubv10013766m

Position : scaf_3 ( 5`- 3048237 .. 3050875 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013766m

Protein [Map View]
MKCFLFSGGDKKGEQKTPNSVSLTSNFSDREINRSGSEFNSRDVSGTSTESSMGRKNSYPTMSTRASNLREFSITDLKSA
TKNFSRSVMIGEGGFGCVFRGTVRSLEDPSIKIEVAVKQLGKRGLQGHKEWVTEVNFLGIVEHTNLVKLLGYCAEDDERG
IQRLLVYEYMPNRSVEFHLSPRSLTVLTWDLRLRIAQDAARGLAYLHEEMEFQIIFRDFKSSNILLDEDWKAKLSDFGLA
RLGPSEGLTHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNKPKGEQKLLEWVRPYLSDTRKF
KLILDPRLEGKYPIKSVQKLAVVANRCLVRNPKTRPKMSEVLEMVTKIVEASSGNGSPQLVPLKSKNASSDAGGKNKRGL
ETKNNGGGGEGGWFGKLWNPKTIRAC*

DNA
ATGAAGTGTTTCTTGTTCTCTGGTGGGGACAAGAAGGGTGAACAGAAGACCCCTAACTCTGTTTCATTGACCTCCAACTT
CTCTGACCGCGAAATCAACCGAAGCGGGTCTGAGTTTAACTCTCGGGATGTCTCTGGGACGAGCACAGAATCATCCATGG
GGAGGAAGAACTCATACCCTACAATGTCTACTAGAGCAAGTAATCTCAGAGAGTTCAGCATTACTGATCTCAAGTCTGCA
ACAAAGAACTTTAGCCGATCTGTTATGATTGGAGAAGGCGGTTTTGGTTGTGTCTTCAGGGGAACAGTGAGGAGTTTAGA
AGACCCCTCAATTAAAATTGAAGTCGCCGTGAAGCAGCTCGGTAAAAGAGGGTTGCAGGGGCATAAGGAATGGGTTACAG
AAGTGAACTTTCTCGGTATAGTTGAGCATACAAACTTGGTGAAATTGCTTGGCTATTGTGCTGAAGATGATGAACGTGGG
ATCCAACGGCTTTTGGTTTATGAATACATGCCTAACCGAAGTGTTGAATTCCACCTGTCCCCTCGGTCACTCACAGTTCT
TACTTGGGACCTCAGATTGAGAATCGCCCAAGATGCAGCTCGCGGCTTAGCATACCTACACGAAGAAATGGAGTTTCAGA
TAATATTCCGCGATTTCAAGTCCTCGAACATTCTTTTGGATGAGGACTGGAAAGCAAAGCTCTCAGATTTCGGTTTGGCG
CGTTTAGGTCCATCTGAAGGACTAACCCATGTATCTACTGATGTTGTAGGTACAATGGGTTATGCGGCACCTGAATACAT
TCAAACAGGCCGTCTCACATCAAAAAGCGATGTGTGGGGTTATGGAGTGTTCCTCTATGAGCTTATCACAGGAAGGCGAC
CAGTAGACAGAAACAAACCAAAGGGAGAGCAGAAGCTTCTAGAATGGGTGAGACCGTATCTATCTGACACAAGGAAGTTC
AAACTCATATTAGACCCGAGGCTGGAAGGGAAGTATCCGATCAAATCAGTTCAAAAGCTAGCAGTTGTGGCCAACAGATG
TTTGGTTAGGAATCCAAAGACACGTCCCAAGATGAGTGAGGTGTTAGAGATGGTGACCAAGATTGTGGAAGCATCTTCAG
GGAACGGCAGCCCACAACTAGTTCCGTTGAAGAGTAAAAACGCCTCAAGTGACGCTGGAGGAAAGAACAAGAGGGGTTTA
GAGACAAAGAACAATGGTGGTGGCGGTGAAGGAGGTTGGTTTGGAAAGTTATGGAACCCAAAGACAATACGAGCTTGTTG
A