Details for Capsella Locus Carubv10013757m

Position : scaf_3 ( 5`- 1637767 .. 1641218 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013757m

Protein [Map View]
MGLGNKGNKFSFGETDLADEGSGADGDSRDEGDGFGSVSCSICLEPVVKNGDRAWANLQCDHQFHLDCIGSAFNAKGVMQ
CPNCRKVEKGQWLYANGCRSYPEFSVEDWVHEEDIYDIGAYSELSFGVHWCPFGSSARLPSFEDGEFTPSSYHDLLGQQG
YYSEPAAPTAGHPCPYVTYFGPVHSSSSSSGGTAGVSDSSSFSSHWNSGSSVSGEVPTPYGFPVDPHYHGWEYHPPPPPP
PQHFSASGAHVGSPTQPTPPPAAARTSRANGSDVIRPRPPHFMRPFHGHNHSSSGRAGSSVASVPRTPPFPGSNARTRDR
MQALQAYYQQSSAQSHQQDSPIVSRGPVFPSGRRPARGIASGMGSTSSSSDQAGGSGFIRFNIWERDPYMQSQQAYSVNQ
MDREPNMWTSSFNEGSGSFHQRHGGGGGSS*

DNA
ATGGGTTTAGGCAATAAGGGTAACAAATTCAGTTTCGGCGAGACTGATCTCGCCGACGAAGGTAGTGGTGCCGATGGCGA
TTCTCGCGACGAAGGTGATGGTTTTGGTTCGGTTTCCTGTTCGATTTGTCTCGAGCCGGTTGTTAAAAACGGCGATCGAG
CCTGGGCTAATCTTCAATGTGACCATCAGTTCCATCTAGACTGTATTGGTTCAGCGTTCAATGCAAAGGGAGTGATGCAA
TGCCCCAACTGTCGGAAAGTAGAAAAAGGCCAGTGGCTTTATGCAAACGGTTGCCGTTCATATCCTGAATTCAGTGTCGA
GGATTGGGTTCATGAAGAAGATATTTACGATATTGGAGCATACTCTGAATTGTCTTTCGGAGTTCACTGGTGCCCATTTG
GAAGCTCAGCACGTCTTCCTTCTTTTGAGGATGGAGAATTTACACCAAGTTCATATCACGATCTCTTGGGACAGCAAGGA
TACTATTCTGAACCAGCAGCGCCAACCGCGGGTCATCCATGTCCATATGTAACCTACTTTGGCCCGGTTCATTCTTCTTC
CTCAAGCAGCGGTGGTACTGCAGGTGTTTCAGACAGTTCAAGTTTCAGTAGTCACTGGAACTCAGGCTCTTCGGTTTCTG
GTGAAGTTCCAACTCCTTATGGTTTCCCTGTGGATCCCCACTATCACGGCTGGGAATATCACCCGCCTCCACCCCCACCA
CCACAGCATTTCTCTGCTTCTGGCGCTCACGTGGGCAGTCCAACTCAACCCACTCCTCCACCAGCTGCTGCGAGAACTTC
CAGAGCCAACGGCTCAGATGTAATCAGACCCAGACCGCCACATTTCATGCGTCCATTTCATGGTCACAATCACAGTTCCA
GCGGTAGAGCGGGTAGTTCGGTGGCATCTGTTCCGAGGACACCGCCATTTCCAGGAAGCAACGCGAGGACGCGAGACAGA
ATGCAAGCTCTTCAAGCCTATTACCAACAGTCTTCTGCACAGTCACACCAGCAGGATTCACCTATAGTATCTCGAGGGCC
TGTATTCCCATCTGGCCGGAGGCCTGCTAGAGGAATAGCTTCCGGGATGGGATCAACATCATCTTCTTCGGATCAGGCAG
GTGGGAGCGGTTTTATCCGGTTTAATATATGGGAGAGAGATCCTTATATGCAATCGCAACAAGCCTACTCAGTTAATCAG
ATGGACAGAGAACCAAACATGTGGACATCATCGTTCAACGAAGGATCTGGAAGCTTCCATCAGAGGCACGGTGGCGGAGG
AGGATCATCATAA