Details for Capsella Locus Carubv10013744m

Position : scaf_3 ( 5`- 7168028 .. 7172670 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013744m

Protein [Map View]
MQSGGDFSNGFHGDHHRELEWEEKQVGGLSSLGRAKRRCRGGPRDLKDGGANVLRVSDQLGEQKSLETSESSPPPCTDFD
VAYFHSYAHVGIHEEMIKDRARTETYKDAITHHQSLIQGKVVVDVGCGTGILSIFCAQAGAKRVYAVDASDIAVQAKEVV
KANGLSDKVIVLHGRVEDVEIDEEVDVIISEWMGYMLLYESMLGSVITARDRWLKPGGLILPSHATLYMAPISHSDRYSH
SIDFWRNVYGINMSPMMQLAKQCAFEEPSVESISGENVLTWPGVVKHIDCQTITIQELDSVTAKYKLKSIMRAPMHGFAF
WFDVEFNGPASSPAKNTGENCAASGSSSIIPSGEGNQKKRTIPSDALLLSTAPEAPPTHWQQTIVYFYDPIDVEQDQVIE
GSVTLSQSKENRRFMNIHLEYSSAGRSFVKESVMR*

DNA
ATGCAATCTGGCGGCGATTTCAGCAACGGCTTCCACGGCGACCATCACCGTGAGCTTGAATGGGAAGAGAAGCAAGTCGG
TGGTCTCAGCTCTTTAGGCCGAGCCAAGAGGCGCTGTCGCGGCGGACCTCGCGACCTTAAAGACGGCGGAGCCAATGTGC
TTAGGGTTTCTGACCAGCTTGGCGAGCAGAAGTCACTGGAGACTTCTGAGTCTTCTCCTCCTCCTTGTACTGACTTCGAC
GTTGCCTATTTCCATTCCTATGCTCACGTTGGAATTCACGAAGAGATGATCAAGGATCGGGCAAGGACGGAAACTTACAA
GGATGCCATTACTCATCATCAGAGCTTGATTCAAGGCAAGGTTGTGGTGGACGTTGGCTGTGGAACAGGCATCCTTTCAA
TCTTCTGTGCTCAAGCAGGTGCAAAACGGGTGTATGCTGTAGATGCAAGTGATATAGCTGTCCAGGCAAAGGAAGTTGTG
AAAGCTAATGGTTTATCCGACAAGGTCATTGTTTTGCATGGGAGAGTGGAGGATGTTGAAATCGACGAGGAGGTTGATGT
TATAATTTCAGAGTGGATGGGTTACATGCTCTTGTATGAGAGTATGCTGGGAAGTGTTATTACAGCTAGAGATCGCTGGT
TGAAGCCTGGGGGTTTGATTCTCCCCTCACATGCAACATTATACATGGCACCTATTTCACACTCTGACAGATATAGCCAC
AGCATTGATTTTTGGCGCAATGTTTATGGAATCAATATGTCTCCGATGATGCAATTAGCTAAACAGTGTGCGTTTGAAGA
ACCCAGTGTGGAGTCAATATCAGGCGAGAATGTTTTAACATGGCCAGGAGTGGTTAAACATATAGACTGTCAAACAATAA
CAATCCAAGAGCTAGACTCCGTTACAGCAAAATATAAACTCAAGTCAATAATGAGAGCTCCTATGCATGGTTTTGCATTT
TGGTTTGACGTTGAGTTCAACGGACCGGCCTCTTCGCCTGCCAAGAATACTGGTGAAAATTGTGCTGCCAGTGGTTCTTC
GTCGATAATTCCTTCTGGAGAAGGAAATCAGAAGAAGCGAACTATTCCGAGTGATGCACTCTTATTGTCCACCGCTCCTG
AAGCTCCTCCAACGCATTGGCAGCAAACGATTGTATATTTCTATGACCCTATAGACGTAGAGCAAGACCAAGTCATTGAA
GGTTCCGTGACACTTTCTCAAAGCAAAGAGAACCGGAGATTCATGAACATCCACCTCGAATATTCCTCGGCTGGCCGTTC
CTTTGTAAAAGAGTCAGTAATGCGTTAA