Details for Capsella Locus Carubv10013722m

Position : scaf_3 ( 5`- 1952744 .. 1956066 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013722m

Protein [Map View]
MMQDSAAQQPEIPIIVGDSSSSSSLHPSSQGDHQVKENSDEDVPSSQSSGTHLDLSIQIPPRPIPFGNGRNPKSSLKSTS
SFKSGTTSSPRGIFRNLSLKKKVFSQTESERSSLLSPGLMETAKKPITPTSTTSPYWKRCLSLPSRHAAKLSPVVSTQVS
AGMPGEPPNKDYVRPAVPRSLSMPGRNKVIVRSISFDNHKARVASETSPADHISPVPPEETDEEIPEEEAVCRICLDVCE
EGNTLKMECSCKGDLRLVHEACAIKWFSTKGTRTCDVCRQEVKNLPVTLVRVPTTNQPTNRRDRSQQNMQSQTASAWQEF
VVLVLISTVCYFFFLEQLLIRDLNKQAIYIAAPFSLMLGLLASVFAIVLAIREYIWTYAALEFALVGMLVHILYATVRLS
AIYSILFAGILGFGIAVCLNSLYLHYFAWRVRIAENSSPV*

DNA
ATGATGCAAGATTCGGCAGCTCAACAACCCGAAATTCCTATTATCGTTGGTGATTCTTCTTCCTCTTCTTCTCTTCATCC
TTCTTCTCAGGGTGATCATCAGGTTAAAGAAAATTCTGATGAAGATGTGCCCAGCTCACAATCTAGCGGAACCCATTTGG
ATCTTTCTATACAAATACCGCCAAGACCAATTCCATTCGGTAACGGCCGTAACCCAAAGAGTTCACTGAAGTCCACAAGT
TCATTCAAAAGTGGTACTACATCCTCACCAAGAGGAATCTTCCGGAATTTAAGCTTGAAAAAGAAAGTTTTTTCCCAAAC
TGAAAGCGAGAGAAGCTCCCTACTATCTCCTGGTCTCATGGAAACTGCAAAGAAGCCCATAACTCCCACTTCAACAACGT
CGCCTTATTGGAAAAGATGCTTGTCTCTTCCTAGTAGACATGCCGCAAAATTGTCTCCTGTTGTATCTACACAAGTTTCA
GCTGGGATGCCTGGTGAACCACCTAATAAAGATTATGTTCGTCCAGCAGTTCCAAGGTCTTTGTCTATGCCCGGAAGAAA
CAAAGTGATTGTGCGATCCATCTCTTTCGACAACCACAAAGCCCGTGTTGCCAGTGAAACAAGTCCAGCAGATCATATAT
CTCCTGTTCCTCCTGAAGAAACTGATGAAGAAATTCCGGAAGAAGAAGCAGTGTGCAGGATCTGTCTGGACGTGTGCGAA
GAAGGTAATACTTTGAAAATGGAGTGCAGCTGCAAAGGTGATCTCAGACTTGTTCATGAAGCGTGTGCCATTAAGTGGTT
TAGTACAAAGGGAACAAGAACCTGTGACGTCTGTAGGCAAGAAGTCAAGAACTTACCAGTTACATTGGTTCGGGTGCCCA
CAACTAATCAACCAACCAACAGGCGGGATCGCAGTCAACAGAATATGCAATCACAAACGGCTAGCGCTTGGCAAGAGTTT
GTGGTGCTAGTACTAATCAGCACAGTCTGCTACTTCTTCTTCCTCGAGCAATTACTGATTCGTGACTTGAACAAGCAAGC
TATCTACATCGCGGCACCATTTTCACTTATGTTAGGCCTCTTAGCATCTGTTTTTGCCATTGTCCTCGCTATCAGAGAAT
ACATATGGACATACGCAGCACTTGAGTTTGCGCTTGTGGGCATGTTGGTTCATATATTATATGCTACAGTTAGGCTATCT
GCGATCTATTCTATACTTTTTGCAGGGATTCTTGGTTTTGGGATAGCTGTGTGCCTAAACTCGTTGTATCTTCATTATTT
CGCTTGGCGTGTACGCATTGCAGAAAACTCAAGCCCAGTATGA